Rabbit anti-Human, Mouse SDCBP Polyclonal Antibody | anti-SDCBP antibody

SDCBP (Syndecan-binding Protein 1, Melanoma Differentiation-associated Protein 9, MDA9, MDA-9, Pro-TGF-alpha Cytoplasmic Domain-interacting Protein 18, TACIP18, Scaffold Protein Pbp1, SYCL, Syntenin-1, ST1) (PE)

Cat. Num. AAA6393485

• Gene Names: SDCBP; ST1; MDA9; SYCL; MDA-9; TACIP18
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SDCBP; Polyclonal Antibody; SDCBP (Syndecan-binding Protein 1; Melanoma Differentiation-associated Protein 9; MDA9; MDA-9; Pro-TGF-alpha Cytoplasmic Domain-interacting Protein 18; TACIP18; Scaffold Protein Pbp1; SYCL; Syntenin-1; ST1) (PE); anti-SDCBP antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SDCBP. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-SDCBP antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human SDCBP, aa1-298 (NP_001007068.1).
• Immunogen Sequence: MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SDCBP rabbit polyclonal antibody. Western Blot analysis of SDCBP expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of SDCBP expression in transfected 293T cell line by SDCBP polyclonal antibody. Lane 1: SDCBP transfected lysate (32.4kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-SDCBP antibody

The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq].

Product Categories/Family for anti-SDCBP antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 55749490
• NCBI GeneID: 6386
• NCBI Accession #: NP_001007068.1
• NCBI GenBank Nucleotide #: NM_001007067
• UniProt Accession #: O00560; O00173; O43391; Q14CP2; B2R5Q7; B4DUH3; B7ZLN2
• Molecular Weight: 31,762 Da
• NCBI Official Full Name: syntenin-1 isoform 1
• NCBI Official Synonym Full Names: syndecan binding protein (syntenin)
• NCBI Official Symbol: SDCBP
• NCBI Official Synonym Symbols: ST1; MDA9; SYCL; MDA-9; TACIP18
• NCBI Protein Information: syntenin-1; melanoma differentiation associated protein-9; melanoma differentiation-associated protein 9; pro-TGF-alpha cytoplasmic domain-interacting protein 18; scaffold protein Pbp1; syndecan-binding protein 1
• UniProt Protein Name: Syntenin-1
• Protein Family: Syntenin
• UniProt Gene Name: SDCBP
• UniProt Synonym Gene Names: MDA9; SYCL; MDA-9; TACIP18
• UniProt Entry Name: SDCB1_HUMAN

NCBI Description

The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

syntenin: Seems to function as an adapter protein. In adherens junctions may function to couple syndecans to cytoskeletal proteins or signaling components. Seems to couple transcription factor SOX4 to the IL-5 receptor (IL5RA). May also play a role in vesicular trafficking. Seems to be required for the targeting of TGFA to the cell surface in the early secretory pathway. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine; Adaptor/scaffold; Vesicle; Motility/polarity/chemotaxis; Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 8q12

Cellular Component: extracellular space; endoplasmic reticulum membrane; focal adhesion; cytosol; adherens junction; cytoskeleton; membrane; cytoplasm; plasma membrane; melanosome; interleukin-5 receptor complex; nucleus; vesicle

Molecular Function: syndecan binding; protein C-terminus binding; identical protein binding; protein homodimerization activity; ephrin receptor binding; protein N-terminus binding; protein binding; interleukin-5 receptor binding; protein heterodimerization activity; frizzled binding; neurexin binding; growth factor binding; cytoskeletal adaptor activity; cell adhesion molecule binding; glycoprotein binding

Biological Process: synaptic transmission; axon guidance; Ras protein signal transduction; ephrin receptor signaling pathway; positive regulation of JNK cascade; actin cytoskeleton organization and biogenesis; protein targeting to membrane; substrate-bound cell migration, cell extension; positive regulation of phosphorylation