Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SDCBP rabbit polyclonal antibody. Western Blot analysis of SDCBP expression in mouse liver.)

Rabbit anti-Human, Mouse SDCBP Polyclonal Antibody | anti-SDCBP antibody

SDCBP (Syndecan-binding Protein 1, Melanoma Differentiation-associated Protein 9, MDA9, MDA-9, Pro-TGF-alpha Cytoplasmic Domain-interacting Protein 18, TACIP18, Scaffold Protein Pbp1, SYCL, Syntenin-1, ST1) (AP)

Gene Names
SDCBP; ST1; MDA9; SYCL; MDA-9; TACIP18
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SDCBP; Polyclonal Antibody; SDCBP (Syndecan-binding Protein 1; Melanoma Differentiation-associated Protein 9; MDA9; MDA-9; Pro-TGF-alpha Cytoplasmic Domain-interacting Protein 18; TACIP18; Scaffold Protein Pbp1; SYCL; Syntenin-1; ST1) (AP); anti-SDCBP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SDCBP. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SDCBP antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SDCBP, aa1-298 (NP_001007068.1).
Immunogen Sequence
MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SDCBP rabbit polyclonal antibody. Western Blot analysis of SDCBP expression in mouse liver.)

Western Blot (WB) (SDCBP rabbit polyclonal antibody. Western Blot analysis of SDCBP expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of SDCBP expression in transfected 293T cell line by SDCBP polyclonal antibody. Lane 1: SDCBP transfected lysate (32.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SDCBP expression in transfected 293T cell line by SDCBP polyclonal antibody. Lane 1: SDCBP transfected lysate (32.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SDCBP antibody
The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq].
Product Categories/Family for anti-SDCBP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,762 Da
NCBI Official Full Name
syntenin-1 isoform 1
NCBI Official Synonym Full Names
syndecan binding protein (syntenin)
NCBI Official Symbol
SDCBP
NCBI Official Synonym Symbols
ST1; MDA9; SYCL; MDA-9; TACIP18
NCBI Protein Information
syntenin-1; melanoma differentiation associated protein-9; melanoma differentiation-associated protein 9; pro-TGF-alpha cytoplasmic domain-interacting protein 18; scaffold protein Pbp1; syndecan-binding protein 1
UniProt Protein Name
Syntenin-1
Protein Family
UniProt Gene Name
SDCBP
UniProt Synonym Gene Names
MDA9; SYCL; MDA-9; TACIP18
UniProt Entry Name
SDCB1_HUMAN

NCBI Description

The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

syntenin: Seems to function as an adapter protein. In adherens junctions may function to couple syndecans to cytoskeletal proteins or signaling components. Seems to couple transcription factor SOX4 to the IL-5 receptor (IL5RA). May also play a role in vesicular trafficking. Seems to be required for the targeting of TGFA to the cell surface in the early secretory pathway. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine; Adaptor/scaffold; Vesicle; Motility/polarity/chemotaxis; Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 8q12

Cellular Component: extracellular space; endoplasmic reticulum membrane; focal adhesion; cytosol; adherens junction; cytoskeleton; membrane; cytoplasm; plasma membrane; melanosome; interleukin-5 receptor complex; nucleus; vesicle

Molecular Function: syndecan binding; protein C-terminus binding; identical protein binding; protein homodimerization activity; ephrin receptor binding; protein N-terminus binding; protein binding; interleukin-5 receptor binding; protein heterodimerization activity; frizzled binding; neurexin binding; growth factor binding; cytoskeletal adaptor activity; cell adhesion molecule binding; glycoprotein binding

Biological Process: synaptic transmission; axon guidance; Ras protein signal transduction; ephrin receptor signaling pathway; positive regulation of JNK cascade; actin cytoskeleton organization and biogenesis; protein targeting to membrane; substrate-bound cell migration, cell extension; positive regulation of phosphorylation

Research Articles on SDCBP

Similar Products

Product Notes

The SDCBP sdcbp (Catalog #AAA6393475) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SDCBP (Syndecan-binding Protein 1, Melanoma Differentiation-associated Protein 9, MDA9, MDA-9, Pro-TGF-alpha Cytoplasmic Domain-interacting Protein 18, TACIP18, Scaffold Protein Pbp1, SYCL, Syntenin-1, ST1) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SDCBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SDCBP sdcbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SDCBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.