Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SAMSN1Sample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)

Rabbit SAMSN1 Polyclonal Antibody | anti-SAMSN1 antibody

SAMSN1 antibody - middle region

Gene Names
SAMSN1; SLy2; HACS1; NASH1; SASH2; SH3D6B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SAMSN1; Polyclonal Antibody; SAMSN1 antibody - middle region; anti-SAMSN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGY
Sequence Length
373
Applicable Applications for anti-SAMSN1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SAMSN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SAMSN1Sample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SAMSN1Sample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-SAMSN1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-SAMSN1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)
Related Product Information for anti-SAMSN1 antibody
This is a rabbit polyclonal antibody against SAMSN1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SAMSN1 is a member of a novel protein family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains.SAMSN1 is a member of a novel gene family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains (Claudio et al., 2001 [PubMed 11536050]).[supplied by OMIM].
Product Categories/Family for anti-SAMSN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
SAM domain-containing protein SAMSN-1 isoform 1
NCBI Official Synonym Full Names
SAM domain, SH3 domain and nuclear localization signals 1
NCBI Official Symbol
SAMSN1
NCBI Official Synonym Symbols
SLy2; HACS1; NASH1; SASH2; SH3D6B
NCBI Protein Information
SAM domain-containing protein SAMSN-1
UniProt Protein Name
SAM domain-containing protein SAMSN-1
UniProt Gene Name
SAMSN1
UniProt Synonym Gene Names
HACS1
UniProt Entry Name
SAMN1_HUMAN

NCBI Description

SAMSN1 is a member of a novel gene family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains (Claudio et al., 2001 [PubMed 11536050]).[supplied by OMIM, Mar 2008]

Uniprot Description

SAMSN1: an adaptor and scaffold protein containing an SH3 and a SAM (sterile alpha motif) domain. Its expression is induced by B cell activation signals. Two alternatively spliced isoforms have been described.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 21q11

Cellular Component: ruffle; cytosol; nucleus

Molecular Function: phosphotyrosine binding

Biological Process: negative regulation of peptidyl-tyrosine phosphorylation; negative regulation of adaptive immune response; negative regulation of B cell activation

Research Articles on SAMSN1

Similar Products

Product Notes

The SAMSN1 samsn1 (Catalog #AAA3207954) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SAMSN1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SAMSN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SAMSN1 samsn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YVDVISEEEA APKKIKANRR SNSKKSKTLQ EFLERIHLQE YTSTLLLNGY. It is sometimes possible for the material contained within the vial of "SAMSN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.