Western Blot (WB)
(WB Suggested Anti-SAMSN1 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)
Rabbit SAMSN1 Polyclonal Antibody | anti-SAMSN1 antibody
SAMSN1 antibody - middle region
Gene Names
SAMSN1; SLy2; HACS1; NASH1; SASH2; SH3D6B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SAMSN1; Polyclonal Antibody; SAMSN1 antibody - middle region; anti-SAMSN1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPS
Sequence Length
373
Applicable Applications for anti-SAMSN1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SAMSN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SAMSN1 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)
Western Blot (WB)
(WB Suggested Anti-SAMSN1 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)
Related Product Information for anti-SAMSN1 antibody
This is a rabbit polyclonal antibody against SAMSN1. It was validated on Western Blot
Target Description: SAMSN1 is a member of a novel protein family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains.
Target Description: SAMSN1 is a member of a novel protein family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains.
Product Categories/Family for anti-SAMSN1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
SAM domain-containing protein SAMSN-1 isoform 1
NCBI Official Synonym Full Names
SAM domain, SH3 domain and nuclear localization signals 1
NCBI Official Symbol
SAMSN1
NCBI Official Synonym Symbols
SLy2; HACS1; NASH1; SASH2; SH3D6B
NCBI Protein Information
SAM domain-containing protein SAMSN-1
UniProt Protein Name
SAM domain-containing protein SAMSN-1
Protein Family
UniProt Gene Name
SAMSN1
UniProt Synonym Gene Names
HACS1
UniProt Entry Name
SAMN1_HUMAN
NCBI Description
SAMSN1 is a member of a novel gene family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains (Claudio et al., 2001 [PubMed 11536050]).[supplied by OMIM, Mar 2008]
Uniprot Description
SAMSN1: an adaptor and scaffold protein containing an SH3 and a SAM (sterile alpha motif) domain. Its expression is induced by B cell activation signals. Two alternatively spliced isoforms have been described.
Protein type: Adaptor/scaffold
Chromosomal Location of Human Ortholog: 21q11
Cellular Component: ruffle; cytosol; nucleus
Molecular Function: phosphotyrosine binding
Biological Process: negative regulation of peptidyl-tyrosine phosphorylation; negative regulation of adaptive immune response; negative regulation of B cell activation
Research Articles on SAMSN1
Similar Products
Product Notes
The SAMSN1 samsn1 (Catalog #AAA3207953) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SAMSN1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SAMSN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SAMSN1 samsn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DISLNKSQLD DCPRDSGCYI SSGNSDNGKE DLESENLSDM VHKIIITEPS. It is sometimes possible for the material contained within the vial of "SAMSN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
