Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (S100A2 rabbit polyclonal antibody. Western Blot analysis of S100A2 expression in human pancreas.)

Rabbit anti-Human, Mouse S100A2 Polyclonal Antibody | anti-S100A2 antibody

S100A2 (S100L, CaN19, Protein S100-A2, Protein S-100L, S100 Calcium-binding Protein A2)

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
S100A2; Polyclonal Antibody; S100A2 (S100L; CaN19; Protein S100-A2; Protein S-100L; S100 Calcium-binding Protein A2); Anti -S100A2 (S100L; anti-S100A2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human S100A2. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP*
Applicable Applications for anti-S100A2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human S100A2, aa1-98 (AAH02829).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(S100A2 rabbit polyclonal antibody. Western Blot analysis of S100A2 expression in human pancreas.)

Western Blot (WB) (S100A2 rabbit polyclonal antibody. Western Blot analysis of S100A2 expression in human pancreas.)

Western Blot (WB)

(S100A2 rabbit polyclonal antibody. Western Blot analysis of S100A2 expression in mouse liver.)

Western Blot (WB) (S100A2 rabbit polyclonal antibody. Western Blot analysis of S100A2 expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of S100A2 expression in transfected 293T cell line by S100A2 polyclonal antibody. Lane 1: S100A2 transfected lysate (10.78kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of S100A2 expression in transfected 293T cell line by S100A2 polyclonal antibody. Lane 1: S100A2 transfected lysate (10.78kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-S100A2 antibody
S100A2 is a 10kD member of the S100 family, EF-hand superfamily of Ca-binding proteins. It is expressed by multiple cell types, including keratinocytes, chondrocytes, and bronchial epithelium. S100A2 regulates both Ca and Zn (in human) within cells, and increases p53 activity. It forms both noncovalent and covalent homodimers, and a homotetramer under certain conditions. Human S100A2 is 98aa in length. It contains two EF-hand motifs (aa13-48 and 51-86) plus a calcium (aa64-75) and zinc (aa17-22) binding site. There is one potential alternative splice form that shows a 40aa insertion after Gly48. Full-length human S100A2 shares 89%, 85% aa identity with bovine and canine S100A2, respectively.
Product Categories/Family for anti-S100A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
11,117 Da
NCBI Official Full Name
S100A2
UniProt Protein Name
Protein S100-A2
Protein Family
UniProt Gene Name
S100A2
UniProt Synonym Gene Names
S100L
UniProt Entry Name
S10A2_HUMAN

Uniprot Description

S100A2: May act as a modulator against excess calcium accumulation in normal human mammary epithelial cells. May also play a role in suppressing tumor cell growth. Belongs to the S-100 family.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 1q21

Molecular Function: identical protein binding; protein binding; calcium ion binding

Biological Process: endothelial cell migration

Similar Products

Product Notes

The S100A2 s100a2 (Catalog #AAA6000034) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The S100A2 (S100L, CaN19, Protein S100-A2, Protein S-100L, S100 Calcium-binding Protein A2) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's S100A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the S100A2 s100a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MCSSLEQALA VLVTTFHKYS CQEGDKFKLS KGEMKELLHK ELPSFVGEKV DEEGLKKLMG SLDENSDQQV DFQEYAVFLA LITVMCNDFF QGCPDRP*. It is sometimes possible for the material contained within the vial of "S100A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.