Rabbit anti-Human, Mouse S100A2 Polyclonal Antibody | anti-S100A2 antibody

S100A2 (S100L, CaN19, Protein S100-A2, Protein S-100L, S100 Calcium-binding Protein A2) (AP)

Cat. Num. AAA6393167

• Gene Names: S100A2; CAN19; S100L
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: S100A2; Polyclonal Antibody; S100A2 (S100L; CaN19; Protein S100-A2; Protein S-100L; S100 Calcium-binding Protein A2) (AP); anti-S100A2 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human S100A2. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-S100A2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human S100A2, aa1-98 (AAH02829).
• Immunogen Sequence: MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(S100A2 rabbit polyclonal antibody. Western Blot analysis of S100A2 expression in human pancreas.)

Western Blot (WB)

(S100A2 rabbit polyclonal antibody. Western Blot analysis of S100A2 expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of S100A2 expression in transfected 293T cell line by S100A2 polyclonal antibody. Lane 1: S100A2 transfected lysate (10.78kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-S100A2 antibody

S100A2 is a 10kD member of the S100 family, EF-hand superfamily of Ca-binding proteins. It is expressed by multiple cell types, including keratinocytes, chondrocytes, and bronchial epithelium. S100A2 regulates both Ca and Zn (in human) within cells, and increases p53 activity. It forms both noncovalent and covalent homodimers, and a homotetramer under certain conditions. Human S100A2 is 98aa in length. It contains two EF-hand motifs (aa13-48 and 51-86) plus a calcium (aa64-75) and zinc (aa17-22) binding site. There is one potential alternative splice form that shows a 40aa insertion after Gly48. Full-length human S100A2 shares 89%, 85% aa identity with bovine and canine S100A2, respectively.

Product Categories/Family for anti-S100A2 antibody

Antibodies; Binding Proteins; Calcium

NCBI and Uniprot Product Information

• NCBI GI #: 33877229
• NCBI GeneID: 6273
• Molecular Weight: 11,117 Da
• NCBI Official Full Name: Homo sapiens S100 calcium binding protein A2, mRNA
• NCBI Official Synonym Full Names: S100 calcium binding protein A2
• NCBI Official Symbol: S100A2
• NCBI Official Synonym Symbols: CAN19; S100L
• NCBI Protein Information: protein S100-A2
• Protein Family: Protein

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may have a tumor suppressor function. Chromosomal rearrangements and altered expression of this gene have been implicated in breast cancer. [provided by RefSeq, Jul 2008]