Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RUNX3 Antibody Titration: 1.25ug/mlELISA Titer: 1:12500Positive Control: NIH/3T3 cell lysate)

Rabbit RUNX3 Polyclonal Antibody | anti-RUNX3 antibody

RUNX3 antibody - C-terminal region

Gene Names
Runx3; AML2; Cbfa3; Pebp2a3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
RUNX3; Polyclonal Antibody; RUNX3 antibody - C-terminal region; anti-RUNX3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PYPGAPQSQSGPFQANPAPYHLFYGASSGSYQFSMAAAGGGERSPTRMLT
Sequence Length
409
Applicable Applications for anti-RUNX3 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse RUNX3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RUNX3 Antibody Titration: 1.25ug/mlELISA Titer: 1:12500Positive Control: NIH/3T3 cell lysate)

Western Blot (WB) (WB Suggested Anti-RUNX3 Antibody Titration: 1.25ug/mlELISA Titer: 1:12500Positive Control: NIH/3T3 cell lysate)
Related Product Information for anti-RUNX3 antibody
This is a rabbit polyclonal antibody against RUNX3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RUNX3 belongs to The RUNX family of transcription factors that are important regulators of linage-specific gene expression in major developmental pathways. Runx3 is highly expressed in developing cranial and dorsal root ganglia (DRGs).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
runt-related transcription factor 3
NCBI Official Synonym Full Names
runt related transcription factor 3
NCBI Official Symbol
Runx3
NCBI Official Synonym Symbols
AML2; Cbfa3; Pebp2a3
NCBI Protein Information
runt-related transcription factor 3
UniProt Protein Name
Runt-related transcription factor 3
UniProt Gene Name
Runx3
UniProt Synonym Gene Names
Aml2; Cbfa3; Pebp2a3; CBF-alpha-3; PEA2-alpha C; PEBP2-alpha C
UniProt Entry Name
RUNX3_MOUSE

Uniprot Description

AML2: CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, lck, IL-3 and GM-CSF promoters. Heterodimer of an alpha and a beta subunit. The alpha subunit binds DNA as a monomer and through the Runt domain. DNA- binding is increased by heterodimerization. Interacts with TLE1 and SUV39H1. The tyrosine phosphorylated form (via runt domain) interacts with SRC (via protein kinase domain). Interacts with FYN and LCK. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding

Cellular Component: Golgi apparatus; intracellular membrane-bound organelle; cytoplasm; nuclear chromatin; nucleolus; nucleus

Molecular Function: protein binding; DNA binding; transcription factor activity; ATP binding

Biological Process: axon guidance; ossification; hair follicle morphogenesis; transcription, DNA-dependent; cell maturation; negative regulation of transcription from RNA polymerase II promoter; protein amino acid phosphorylation; mRNA transcription from RNA polymerase II promoter; negative regulation of cell cycle; regulation of transcription, DNA-dependent; regulation of cell differentiation; interferon-gamma production; chondrocyte differentiation; hemopoiesis; neurite development; negative regulation of epithelial cell proliferation

Research Articles on RUNX3

Similar Products

Product Notes

The RUNX3 runx3 (Catalog #AAA3203522) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RUNX3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RUNX3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RUNX3 runx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PYPGAPQSQS GPFQANPAPY HLFYGASSGS YQFSMAAAGG GERSPTRMLT. It is sometimes possible for the material contained within the vial of "RUNX3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.