Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RUNX1T1 expression in transfected 293T cell line by RUNX1T1 polyclonal antibody. Lane 1: RUNX1T1 transfected lysate (64.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human RUNX1T1 Polyclonal Antibody | anti-RUNX1T1 antibody

RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Protein MTG8, Zinc Finger MYND Domain-containing Protein 2, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2) (HRP)

Gene Names
RUNX1T1; CDR; ETO; MTG8; AML1T1; ZMYND2; CBFA2T1; AML1-MTG8
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RUNX1T1; Polyclonal Antibody; RUNX1T1 (Protein CBFA2T1; Cyclin-D-related Protein; Eight Twenty One Protein; Protein ETO; Protein MTG8; Zinc Finger MYND Domain-containing Protein 2; AML1T1; CBFA2T1; CDR; ETO; MTG8; ZMYND2) (HRP); anti-RUNX1T1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RUNX1T1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
577
Applicable Applications for anti-RUNX1T1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RUNX1T1, aa1-577 (NP_004340.1).
Immunogen Sequence
MPDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RUNX1T1 expression in transfected 293T cell line by RUNX1T1 polyclonal antibody. Lane 1: RUNX1T1 transfected lysate (64.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RUNX1T1 expression in transfected 293T cell line by RUNX1T1 polyclonal antibody. Lane 1: RUNX1T1 transfected lysate (64.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between RUNX1T1 and HDAC1 HeLa cells were stained with RUNX1T1 rabbit purified polyclonal 1:1200 and HDAC1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between RUNX1T1 and HDAC1 HeLa cells were stained with RUNX1T1 rabbit purified polyclonal 1:1200 and HDAC1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-RUNX1T1 antibody
Transcription regulator that excerts its function by binding to histone deacetylases and transcription factors. Can repress transactivation mediated by TCF12.
Product Categories/Family for anti-RUNX1T1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
862
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
protein CBFA2T1 isoform A
NCBI Official Synonym Full Names
RUNX1 partner transcriptional co-repressor 1
NCBI Official Symbol
RUNX1T1
NCBI Official Synonym Symbols
CDR; ETO; MTG8; AML1T1; ZMYND2; CBFA2T1; AML1-MTG8
NCBI Protein Information
protein CBFA2T1
UniProt Protein Name
Protein CBFA2T1
Protein Family
UniProt Gene Name
RUNX1T1
UniProt Synonym Gene Names
AML1T1; CBFA2T1; CDR; ETO; MTG8; ZMYND2
UniProt Entry Name
MTG8_HUMAN

NCBI Description

This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]

Uniprot Description

RUNX1T1: Transcription regulator that excerts its function by binding to histone deacetylases and transcription factors. Can repress transactivation mediated by TCF12. Homotetramer. Heterotetramer with CBFA2T2 and CBFA2T3. Interacts with TCF12, SIN3A, HDAC1, HDAC2, HDAC3, NCOR1 and NCOR2. Interacts with ATN1 (via its N-terminus); the interaction enhances the transcriptional repression. Most abundantly expressed in brain. Lower levels in lung, heart, testis and ovary. Belongs to the CBFA2T family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription regulation; Oncoprotein

Chromosomal Location of Human Ortholog: 8q22

Cellular Component: nucleoplasm; nuclear matrix; mitochondrion; cytoplasm

Molecular Function: identical protein binding; protein binding; DNA binding; metal ion binding; transcription factor activity; transcription corepressor activity

Biological Process: generation of precursor metabolites and energy; transcription, DNA-dependent; negative regulation of transcription, DNA-dependent

Research Articles on RUNX1T1

Similar Products

Product Notes

The RUNX1T1 runx1t1 (Catalog #AAA6393105) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Protein MTG8, Zinc Finger MYND Domain-containing Protein 2, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RUNX1T1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RUNX1T1 runx1t1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RUNX1T1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.