Mouse anti-Human RUNX1T1 Monoclonal Antibody | anti-RUNX1T1 antibody

RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Protein MTG8, Zinc Finger MYND Domain-containing Protein 2, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2) (HRP)

Cat. Num. AAA6154785

• Gene Names: RUNX1T1; CDR; ETO; MTG8; AML1T1; ZMYND2; CBFA2T1; AML1-MTG8
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RUNX1T1; Monoclonal Antibody; RUNX1T1 (Protein CBFA2T1; Cyclin-D-related Protein; Eight Twenty One Protein; Protein ETO; Protein MTG8; Zinc Finger MYND Domain-containing Protein 2; AML1T1; CBFA2T1; CDR; ETO; MTG8; ZMYND2) (HRP); anti-RUNX1T1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5A12
• Specificity: Recognizes human RUNX1T1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-RUNX1T1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa416-525 from human RUNX1T1 (NP_004340) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICG
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RUNX1T1 expression in transfected 293T cell line by RUNX1T1 monoclonal antibody. Lane 1: RUNX1T1 transfected lysate (67.566kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RUNX1T1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged RUNX1T1 is ~0.3ng/ml as a capture antibody)

Related Product Information for anti-RUNX1T1 antibody

Transcription regulator that excerts its function by binding to histone deacetylases and transcription factors. Can repress transactivation mediated by TCF12.

Product Categories/Family for anti-RUNX1T1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4757916
• NCBI GeneID: 862
• NCBI Accession #: NP_004340
• NCBI GenBank Nucleotide #: NM_004349
• UniProt Accession #: B2R6I9; Q06455
• Molecular Weight: 64kDa
• NCBI Official Full Name: protein CBFA2T1 isoform A
• NCBI Official Synonym Full Names: RUNX1 translocation partner 1
• NCBI Official Symbol: RUNX1T1
• NCBI Official Synonym Symbols: CDR; ETO; MTG8; AML1T1; ZMYND2; CBFA2T1; AML1-MTG8
• NCBI Protein Information: protein CBFA2T1
• Protein Family: Protein

NCBI Description

This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]