Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of RPA70 expression in HELA whole cell lysates (lane 1), JURKAT whole cell lysates (lane 2) and COLO320 whole cell lysates (lane 3). RPA70 at 70KD was detected using rabbit anti- RPA70 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

anti-Human RPA70 Polyclonal Antibody | anti-RPA70 antibody

Anti-RPA70 Antibody

Gene Names
RPA1; HSSB; RF-A; RP-A; REPA1; RPA70; MST075
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
RPA70; Polyclonal Antibody; Anti-RPA70 Antibody; Replication protein A 70 kDa DNA-binding subunit; Dmrpa1; Drosophila Replication Protein A; DRPA; HSSB; Human single stranded DNA binding protein; MST075; MSTP075; p70; REPA1; Replication factor A; Replication factor A protein 1; Replication protein A 70kDa DNA binding subunit; Replication protein A1 70kDa; Replication protein A1; RF A; RF-A protein 1; RFA; RFA1_HUMAN; RP A; RP-A p70; RPA 70; RPA; rpa1; Single stranded binding protein 70; Single-stranded DNA-binding protein; replication protein A1; anti-RPA70 antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
616
Applicable Applications for anti-RPA70 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human RPA70 (533-568aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR), different from the related mouse sequence by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of RPA70 expression in HELA whole cell lysates (lane 1), JURKAT whole cell lysates (lane 2) and COLO320 whole cell lysates (lane 3). RPA70 at 70KD was detected using rabbit anti- RPA70 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of RPA70 expression in HELA whole cell lysates (lane 1), JURKAT whole cell lysates (lane 2) and COLO320 whole cell lysates (lane 3). RPA70 at 70KD was detected using rabbit anti- RPA70 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-RPA70 antibody
Description: Rabbit IgG polyclonal antibody for Replication protein A 70 kDa DNA-binding subunit(RPA1) detection. Tested with WB in Human.

Background: Replication protein A 70 kDa DNA-binding subunit is a protein that in humans is encoded by the RPA1 gene. This gene is mapped to chromosome 17p13.3. Replication protein A (RPA) is a heterotrimeric single-strand DNA (ssDNA)-binding protein essential for DNA replication, repair, and recombination. It is composed of 70-kD (RPA1), 32-kD (RPA2), and 14-kD (RPA3) subunits. The RPA1 subunit is responsible for high-affinity ssDNA binding. The RPA complex was originally isolated as a factor essential for in vitro replication of the papovavirus SV40. It had been found that recombinant human RPA1, purified from bacteria, exhibited ssDNA-binding activity comparable to that of the complete RPA complex. RPA1 could substitute for the complete complex in stimulating the activity of DNA polymerase alpha-primase, but it could not substitute for the complete complex in SV40 DNA replication in vitro, suggesting an important functional role for the other subunits.
References
1. Erdile, L. F., Heyer, W.-D., Kolodner, R., Kelly, T. J. Characterization of a cDNA encoding the 70-kDa single-stranded DNA-binding subunit of human replication protein A and the role of the protein in DNA replication. J. Biol. Chem. 266: 12090-12098, 1991. Note: Erratum: J. Biol. Chem. 268: 2268 only, 1993. 2. Haring, S. J., Mason, A. C., Binz, S. K., Wold, M. S. Cellular functions of human RPA1: multiple roles of domains in replication, repair, and checkpoints. J. Biol. Chem. 283: 19095-19111, 2008.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68,138 Da
NCBI Official Full Name
replication protein A 70 kDa DNA-binding subunit
NCBI Official Synonym Full Names
replication protein A1
NCBI Official Symbol
RPA1
NCBI Official Synonym Symbols
HSSB; RF-A; RP-A; REPA1; RPA70; MST075
NCBI Protein Information
replication protein A 70 kDa DNA-binding subunit
UniProt Protein Name
Replication protein A 70 kDa DNA-binding subunit
UniProt Gene Name
RPA1
UniProt Synonym Gene Names
REPA1; RPA70; RP-A p70; RF-A protein 1
UniProt Entry Name
RFA1_HUMAN

Uniprot Description

RPA1: Plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair. Binds and subsequently stabilizes single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. Heterotrimer composed of RPA1, RPA2 and RPA3 (canonical replication protein A complex). Component of the alternative replication protein A complex (aRPA) composed of RPA1, RPA3 and RPA4. The DNA-binding activity may reside exclusively on the RPA1 subunit. Interacts with RIPK1 and XPA. Interacts with RPA4. Interacts with the polymerase alpha subunit POLA1/p180; this interaction stabilizes the replicative complex and reduces the misincorporation rate of DNA polymerase alpha by acting as a fidelity clamp. Interact with RAD51 and SENP6 to regulate DNA repair. Interacts with HELB; this interaction promotes HELB recruitement to chromatin following DNA damage. Belongs to the replication factor A protein 1 family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: DNA replication factor A complex; nuclear chromosome, telomeric region; nucleoplasm; nucleus; PML body

Molecular Function: damaged DNA binding; metal ion binding; protein binding; single-stranded DNA binding

Biological Process: base-excision repair; bypass DNA synthesis; DNA damage response, detection of DNA damage; DNA recombination; DNA repair; DNA replication; DNA-dependent DNA replication; double-strand break repair via homologous recombination; error-prone postreplication DNA repair; G1/S transition of mitotic cell cycle; mismatch repair; nucleotide-excision repair; nucleotide-excision repair, DNA gap filling; nucleotide-excision repair, DNA incision; nucleotide-excision repair, DNA incision, 3'-to lesion; nucleotide-excision repair, DNA incision, 5'-to lesion; nucleotide-excision repair, preincision complex assembly; nucleotide-excision repair, preincision complex stabilization; protein sumoylation; telomere maintenance; telomere maintenance via recombination; transcription-coupled nucleotide-excision repair

Research Articles on RPA70

Similar Products

Product Notes

The RPA70 rpa1 (Catalog #AAA177992) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-RPA70 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RPA70 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the RPA70 rpa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RPA70, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.