Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using RNF144A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Rabbit anti-Human, Rat RNF144A Polyclonal Antibody | anti-RNF144A antibody

RNF144A Rabbit pAb

Gene Names
RNF144A; RNF144; UBCE7IP4
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
RNF144A; Polyclonal Antibody; RNF144A Rabbit pAb; RNF144; UBCE7IP4; hUIP4; anti-RNF144A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
ELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDD
Applicable Applications for anti-RNF144A antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 52-179 of human RNF144A (NP_055561.2).
Positive Samples
A-431, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using RNF144A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using RNF144A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-RNF144A antibody
Background: This gene encodes a member of a family of RING finger domain-containing E3 ubiquitin ligases that also includes parkin and parc. The expression of this gene is induced by DNA damage. The encoded protein interacts with the cytoplasmic DNA-dependent protein kinase, catalytic subunit (DNA-PKcs) and promotes its degradation through ubiquitination. The orthologous mouse protein has been shown to interact with a ubiquitin-conjugating enzyme involved in embryonic development. [provided by RefSeq, Mar 2017]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,890 Da
NCBI Official Full Name
probable E3 ubiquitin-protein ligase RNF144A
NCBI Official Synonym Full Names
ring finger protein 144A
NCBI Official Symbol
RNF144A
NCBI Official Synonym Symbols
RNF144; UBCE7IP4
NCBI Protein Information
probable E3 ubiquitin-protein ligase RNF144A; UbcM4-interacting protein 4; ubiquitin conjugating enzyme 7 interacting protein 4; ubiquitin-conjugating enzyme 7-interacting protein 4
UniProt Protein Name
Probable E3 ubiquitin-protein ligase RNF144A
UniProt Gene Name
RNF144A
UniProt Synonym Gene Names
KIAA0161; RNF144; UBCE7IP4
UniProt Entry Name
R144A_HUMAN

NCBI Description

The protein encoded by this protein contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. The mouse counterpart of this protein has been shown to interact with Ube2l3/UbcM4, which is an ubiquitin-conjugating enzyme involved in embryonic development. [provided by RefSeq, Jul 2008]

Uniprot Description

RNF144A: E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Belongs to the RBR family. RNF144 subfamily.

Protein type: Ligase; EC 6.3.2.-; Membrane protein, integral; Ubiquitin conjugating system; Ubiquitin ligase; EC 6.3.2.19

Chromosomal Location of Human Ortholog: 2p25.2

Cellular Component: Golgi apparatus; cytoplasmic vesicle membrane; plasma membrane; integral to membrane

Molecular Function: zinc ion binding; ligase activity

Biological Process: protein ubiquitination

Research Articles on RNF144A

Similar Products

Product Notes

The RNF144A rnf144a (Catalog #AAA9142866) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNF144A Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RNF144A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the RNF144A rnf144a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ELLIKEGLET AISCPDAACP KQGHLQENEI ECMVAAEIMQ RYKKLQFERE VLFDPCRTWC PASTCQAVCQ LQDVGLQTPQ PVQCKACRME FCSTCKASWH PGQGCPETMP ITFLPGETSA AFKMEEDD. It is sometimes possible for the material contained within the vial of "RNF144A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.