Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GZMASample Type: HEK293TAntibody Dilution: 0.2 ug/ml)

Rabbit GZMA Polyclonal Antibody | anti-GZMA antibody

GZMA antibody - middle region

Gene Names
GZMA; HFSP; CTLA3
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GZMA; Polyclonal Antibody; GZMA antibody - middle region; anti-GZMA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNS
Sequence Length
262
Applicable Applications for anti-GZMA antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 79%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GZMA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GZMASample Type: HEK293TAntibody Dilution: 0.2 ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GZMASample Type: HEK293TAntibody Dilution: 0.2 ug/ml)

Western Blot (WB)

(WB Suggested Anti-GZMA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateGZMA is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-GZMA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateGZMA is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-GZMA antibody
This is a rabbit polyclonal antibody against GZMA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-GZMA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
granzyme A
NCBI Official Synonym Full Names
granzyme A
NCBI Official Symbol
GZMA
NCBI Official Synonym Symbols
HFSP; CTLA3
NCBI Protein Information
granzyme A
UniProt Protein Name
Granzyme A
Protein Family
UniProt Gene Name
GZMA
UniProt Synonym Gene Names
CTLA3; HFSP; H factor; HF
UniProt Entry Name
GRAA_HUMAN

NCBI Description

Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. [provided by RefSeq, Jul 2008]

Uniprot Description

GZMA: This enzyme is necessary for target cell lysis in cell- mediated immune responses. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Involved in apoptosis. Homodimer; disulfide-linked. Interacts with APEX1. Dexamethasone (DEX) induces expression of isoform beta and represses expression of isoform alpha. The alteration in expression is mediated by binding of glucocorticoid receptor to independent promoters adjacent to the alternative first exons of isoform alpha and isoform beta. Belongs to the peptidase S1 family. Granzyme subfamily. 2 isoforms of the human protein are produced by alternative promoter.

Protein type: Apoptosis; Secreted, signal peptide; Protease; EC 3.4.21.78; Secreted

Chromosomal Location of Human Ortholog: 5q11-q12

Cellular Component: extracellular region; immunological synapse; nucleus

Molecular Function: protein binding; protein homodimerization activity; serine-type endopeptidase activity

Biological Process: proteolysis involved in cellular protein catabolic process; positive regulation of apoptosis; apoptosis; cytolysis; negative regulation of oxidoreductase activity; negative regulation of endodeoxyribonuclease activity; immune response; negative regulation of DNA binding

Research Articles on GZMA

Similar Products

Product Notes

The GZMA gzma (Catalog #AAA3211864) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GZMA antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GZMA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GZMA gzma for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TREGDLKLLQ LTEKAKINKY VTILHLPKKG DDVKPGTMCQ VAGWGRTHNS. It is sometimes possible for the material contained within the vial of "GZMA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.