Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GLRBSample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit GLRB Polyclonal Antibody | anti-GLRB antibody

GLRB Antibody - N-terminal region

Gene Names
GLRB; HKPX2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GLRB; Polyclonal Antibody; GLRB Antibody - N-terminal region; anti-GLRB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLTTAFLILISLWVEEAYSKEKSSKKGKGKKKQYLCPSQQSAEDLARVPA
Sequence Length
497
Applicable Applications for anti-GLRB antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GLRB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GLRBSample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GLRBSample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GLRB antibody
This is a rabbit polyclonal antibody against GLRB. It was validated on Western Blot

Target Description: This gene encodes the beta subunit of the glycine receptor, which is a pentamer composed of alpha and beta subunits. The receptor functions as a neurotransmitter-gated ion channel, which produces hyperpolarization via increased chloride conductance due to the binding of glycine to the receptor. Mutations in this gene cause startle disease, also known as hereditary hyperekplexia or congenital stiff-person syndrome, a disease characterized by muscular rigidity. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-GLRB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
glycine receptor subunit beta isoform A
NCBI Official Synonym Full Names
glycine receptor beta
NCBI Official Symbol
GLRB
NCBI Official Synonym Symbols
HKPX2
NCBI Protein Information
glycine receptor subunit beta
UniProt Protein Name
Glycine receptor subunit beta
Protein Family
UniProt Gene Name
GLRB
UniProt Entry Name
GLRB_HUMAN

NCBI Description

This gene encodes the beta subunit of the glycine receptor, which is a pentamer composed of alpha and beta subunits. The receptor functions as a neurotransmitter-gated ion channel, which produces hyperpolarization via increased chloride conductance due to the binding of glycine to the receptor. Mutations in this gene cause startle disease, also known as hereditary hyperekplexia or congenital stiff-person syndrome, a disease characterized by muscular rigidity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

Uniprot Description

GLRB: The glycine receptor is a neurotransmitter-gated ion channel. Binding of glycine to its receptor increases the chloride conductance and thus produces hyperpolarization (inhibition of neuronal firing). Defects in GLRB are the cause of hyperekplexia type 2 (HKPX2). HKPX2 is a neurologic disorder characterized by muscular rigidity of central nervous system origin, particularly in the neonatal period, and by an exaggerated startle response to unexpected acoustic or tactile2 stimuli. Belongs to the ligand-gated ion channel (TC 1.A.9) family. Glycine receptor (TC 1.A.9.3) subfamily. GLRB sub- subfamily.

Protein type: Membrane protein, multi-pass; Transporter, ion channel; Transporter; Membrane protein, integral; Channel, ligand-gated

Chromosomal Location of Human Ortholog: 4q31.3

Cellular Component: postsynaptic membrane; integral to plasma membrane; plasma membrane; cell junction

Molecular Function: protein binding; extracellular-glycine-gated chloride channel activity; glycine binding; extracellular-glycine-gated ion channel activity; drug binding

Biological Process: nervous system development; startle response; synaptic transmission, glycinergic; righting reflex; protein heterooligomerization; acrosome reaction; adult walking behavior; synaptic transmission; regulation of membrane potential; visual perception; neuropeptide signaling pathway; ion transport; transmembrane transport

Disease: Hyperekplexia 2

Research Articles on GLRB

Similar Products

Product Notes

The GLRB glrb (Catalog #AAA3202396) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GLRB Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GLRB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GLRB glrb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLTTAFLILI SLWVEEAYSK EKSSKKGKGK KKQYLCPSQQ SAEDLARVPA. It is sometimes possible for the material contained within the vial of "GLRB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.