Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RIPK4Sample Tissue: Human HT1080Whole CellAntibody Dilution: 1ug/ml)

Rabbit RIPK4 Polyclonal Antibody | anti-RIPK4 antibody

RIPK4 Antibody - C - terminal region

Gene Names
RIPK4; DIK; PKK; PPS2; RIP4; ANKK2; NKRD3; ANKRD3; CHANDS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RIPK4; Polyclonal Antibody; RIPK4 Antibody - C - terminal region; anti-RIPK4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT
Sequence Length
784
Applicable Applications for anti-RIPK4 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RIPK4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RIPK4Sample Tissue: Human HT1080Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RIPK4Sample Tissue: Human HT1080Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: RIPK4Sample Tissue: Human HT1080Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RIPK4Sample Tissue: Human HT1080Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: RIPK4Sample Tissue: Human HT1080Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RIPK4Sample Tissue: Human HT1080Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-RIPK4 Antibody Titration: 0.2-1 ug/mlPositive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-RIPK4 Antibody Titration: 0.2-1 ug/mlPositive Control: 293T cell lysate)
Related Product Information for anti-RIPK4 antibody
This is a rabbit polyclonal antibody against RIPK4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RIPK4 is a serine/threonine protein kinase that interacts with protein kinase C-delta. The protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation.The protein encoded by this gene is a serine/threonine protein kinase that interacts with protein kinase C-delta. The encoded protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation.
Product Categories/Family for anti-RIPK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
receptor-interacting serine/threonine-protein kinase 4
NCBI Official Synonym Full Names
receptor interacting serine/threonine kinase 4
NCBI Official Symbol
RIPK4
NCBI Official Synonym Symbols
DIK; PKK; PPS2; RIP4; ANKK2; NKRD3; ANKRD3; CHANDS
NCBI Protein Information
receptor-interacting serine/threonine-protein kinase 4
UniProt Protein Name
Receptor-interacting serine/threonine-protein kinase 4
UniProt Gene Name
RIPK4
UniProt Synonym Gene Names
ANKRD3; DIK
UniProt Entry Name
RIPK4_HUMAN

NCBI Description

The protein encoded by this gene is a serine/threonine protein kinase that interacts with protein kinase C-delta. The encoded protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation. [provided by RefSeq, Jul 2008]

Uniprot Description

ANKRD3: a TKL protein kinase of the RIPK family. Activates NFkappaB when overexpressed in cell lines and is required for keratinocyte differentiation in vivo. Appears to activate NFkappaB in both a kinase-dependent as well as a kinase-independent manner. Contains 10 ANK repeats. Two alternatively spliced isoforms have been described.

Protein type: Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; Protein kinase, TKL; Kinase, protein; TKL group; RIPK family

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: membrane; cytoplasm; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding

Biological Process: morphogenesis of an epithelium; protein amino acid phosphorylation; activation of NF-kappaB transcription factor

Disease: Popliteal Pterygium Syndrome, Lethal Type

Research Articles on RIPK4

Similar Products

Product Notes

The RIPK4 ripk4 (Catalog #AAA3207950) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RIPK4 Antibody - C - terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RIPK4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RIPK4 ripk4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLSALHLAAQ GRHAQTVETL LRHGAHINLQ SLKFQGGHGP AATLLRRSKT. It is sometimes possible for the material contained within the vial of "RIPK4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.