Mouse anti-Human CABLES1 Polyclonal Antibody | anti-CABLES1 antibody

CABLES1 (CDK5 and ABL1 Enzyme Substrate 1, Interactor with CDK3 1, Ik3-1, CABLES)

Cat. Num. AAA645949

• Gene Names: CABLES1; CABL1; IK3-1; CABLES; HsT2563
• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: CABLES1; Polyclonal Antibody; CABLES1 (CDK5 and ABL1 Enzyme Substrate 1; Interactor with CDK3 1; Ik3-1; CABLES); Anti -CABLES1 (CDK5 and ABL1 Enzyme Substrate 1; anti-CABLES1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CABLES1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MLSKRGCHARIYADFPIRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKNFKKIHFIKNMRQHDTRNGRIVLISGRRSFCSIFSVLPYRDSTQVGDLKLDGGRQSTGAVSLKEIIGLEGVELGADGKTVSYTQFLLPTNAFGARRNTIDSTSSFSQFRNLSHRSLSIGRASGTQGSLDTGSDLGDFMDYDPNLLDDPQWPCGKHKRVLIFPSYMTTVIDYVKPSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRKLCAGACVLLAAKIGSDLKKHEVKHLIDKLEEKFRLNRRELIAFEFPVLVALEFALHLPEHEVMPHYRRLVQSS

• Applicable Applications for anti-CABLES1 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human CABLES1, aa1-368 (NP_612384.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CABLES1 expression in transfected 293T cell line by CABLES1 polyclonal antibody. Lane 1: CABLES1 transfected lysate (40.48kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to CABLES1 on HeLa cell. [antibody concentration 10ug/ml].)

Related Product Information for anti-CABLES1 antibody

Cyclin-dependent kinase binding protein. Enhances cyclin-dependent kinase tyrosine phosphorylation by nonreceptor tyrosine kinases, such as that of CDK5 by activated ABL1, which leads to increased CDK5 activity and is critical for neuronal development, and that of CDK2 by WEE1, which leads to decreased CDK2 activity and growth inhibition. Positively affects neuronal outgrowth. Plays a role as a regulator for p53/p73-induced cell death

Product Categories/Family for anti-CABLES1 antibody

Antibodies; Abs to Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 374253774
• NCBI GeneID: 91768
• NCBI Accession #: NP_001243367.1
• NCBI GenBank Nucleotide #: NM_001256438.1
• UniProt Accession #: Q8TDN4; Q8N3Y8; Q8NA22; Q9BTG1; B4DK60
• Molecular Weight: 67,599 Da
• NCBI Official Full Name: CDK5 and ABL1 enzyme substrate 1 isoform 3
• NCBI Official Synonym Full Names: Cdk5 and Abl enzyme substrate 1
• NCBI Official Symbol: CABLES1
• NCBI Official Synonym Symbols: CABL1; IK3-1; CABLES; HsT2563
• NCBI Protein Information: CDK5 and ABL1 enzyme substrate 1; interactor with CDK3 1
• UniProt Protein Name: CDK5 and ABL1 enzyme substrate 1
• Protein Family: CDK5 and ABL1 enzyme substrate
• UniProt Gene Name: CABLES1
• UniProt Synonym Gene Names: CABLES; Ik3-1
• UniProt Entry Name: CABL1_HUMAN

NCBI Description

This gene encodes a protein involved in regulation of the cell cycle through interactions with several cyclin-dependent kinases. One study (PMID: 16177568) reported aberrant splicing of transcripts from this gene which results in removal of the cyclin binding domain only in human cancer cells, and reduction in gene expression was shown in colorectal cancers (PMID: 17982127).Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

Function: Cyclin-dependent kinase binding protein. Enhances cyclin-dependent kinase tyrosine phosphorylation by nonreceptor tyrosine kinases, such as that of CDK5 by activated ABL1, which leads to increased CDK5 activity and is critical for neuronal development, and that of CDK2 by WEE1, which leads to decreased CDK2 activity and growth inhibition. Positively affects neuronal outgrowth. Plays a role as a regulator for p53/p73-induced cell death

By similarity.

Subunit structure: Found in a complex with p53/TP53. Found in a number of complexes with CDK2, CDK3, CDK5, ABL1, TDRD7, CDK17, CCNA1, CCNE1 and TP73. Interacts with CDK2, CDK3, CDK5, ABL1 and TDRD7

By similarity. Ref.5

Subcellular location: Nucleus

By similarity. Cytoplasm

By similarity. Note: Located in the cell body and proximal region of the developing axonal shaft of immature neurons. Located in axonal growth cone, but not in the distal part of the axon shaft or in dendritic growth cone of mature neurons

By similarity. Ref.4 Ref.5

Tissue specificity: Expressed in breast, pancreas, colon, head and neck (at protein level). Strongly decreased in more than half of cases of atypical endometrial hyperplasia and in more than 90% of endometrial cancers. Ref.4 Ref.6

Developmental stage: Expression in the endometrial epithelium fluctuates during the menstrual cycle, being greater during the secretory phase when compared with the proliferative phase. Ref.6

Induction: Up-regulated by progesterone and down-regulated by estrogen in benign endometrium. Ref.6

Post-translational modification: Phosphorylated on Ser-313 by CCNE1/CDK3. Phosphorylated on serine/threonine residues by CDK5 and on tyrosine residues by ABL1. Also phosphorylated in vitro by CCNA1/CDK2, CCNE1/CDK2, CCNA1/CDK3 and CCNE1/CDK3

By similarity.

Sequence similarities: Belongs to the cyclin family.