Immunohistochemistry (IHC)
(Human kidney )
Rabbit RIMS3 Polyclonal Antibody | anti-RIMS3 antibody
RIMS3 antibody - C-terminal region
Gene Names
RIMS3; NIM3; RIM3; RIM 3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
RIMS3; Polyclonal Antibody; RIMS3 antibody - C-terminal region; anti-RIMS3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IMLDELDLSAAVTGWYKLFPTSSVADSTLGSLTRRLSQSSLESATSPSCS
Sequence Length
308
Applicable Applications for anti-RIMS3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RIMS3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human kidney )
Immunohistochemistry (IHC)
(Human kidney )
Western Blot (WB)
(Host: MouseTarget Name: RIMS3Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: MouseTarget Name: RIMS3Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-RIMS3 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateRIMS3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Western Blot (WB)
(WB Suggested Anti-RIMS3 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateRIMS3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-RIMS3 antibody
This is a rabbit polyclonal antibody against RIMS3. It was validated on Western Blot and immunohistochemistry
Target Description: RIMS3 belongs to a family of synaptic proteins that are essential for normal neurotransmitter release.
Target Description: RIMS3 belongs to a family of synaptic proteins that are essential for normal neurotransmitter release.
Product Categories/Family for anti-RIMS3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
regulating synaptic membrane exocytosis protein 3
NCBI Official Synonym Full Names
regulating synaptic membrane exocytosis 3
NCBI Official Symbol
RIMS3
NCBI Official Synonym Symbols
NIM3; RIM3; RIM 3
NCBI Protein Information
regulating synaptic membrane exocytosis protein 3
UniProt Protein Name
Regulating synaptic membrane exocytosis protein 3
Protein Family
UniProt Gene Name
RIMS3
UniProt Synonym Gene Names
KIAA0237; Nim3; RIM 3
UniProt Entry Name
RIMS3_HUMAN
Uniprot Description
RIMS3: Regulates synaptic membrane exocytosis.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 1p34.2
Cellular Component: presynaptic active zone; cell junction
Biological Process: regulation of membrane potential; neurotransmitter transport; calcium ion-dependent exocytosis
Research Articles on RIMS3
Similar Products
Product Notes
The RIMS3 rims3 (Catalog #AAA3202252) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RIMS3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RIMS3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the RIMS3 rims3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IMLDELDLSA AVTGWYKLFP TSSVADSTLG SLTRRLSQSS LESATSPSCS. It is sometimes possible for the material contained within the vial of "RIMS3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
