Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RHOCSample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human RHOC Polyclonal Antibody | anti-RHOC antibody

RHOC Antibody - middle region

Gene Names
RHOC; H9; ARH9; ARHC; RHOH9
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RHOC; Polyclonal Antibody; RHOC Antibody - middle region; anti-RHOC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKT
Sequence Length
193
Applicable Applications for anti-RHOC antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RHOC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RHOCSample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RHOCSample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RHOC antibody
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
389
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21 kDa
NCBI Official Full Name
rho-related GTP-binding protein RhoC
NCBI Official Synonym Full Names
ras homolog family member C
NCBI Official Symbol
RHOC
NCBI Official Synonym Symbols
H9; ARH9; ARHC; RHOH9
NCBI Protein Information
rho-related GTP-binding protein RhoC
UniProt Protein Name
Rho-related GTP-binding protein RhoC
UniProt Gene Name
RHOC
UniProt Synonym Gene Names
ARH9; ARHC; h9
UniProt Entry Name
RHOC_HUMAN

NCBI Description

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Research Articles on RHOC

Similar Products

Product Notes

The RHOC rhoc (Catalog #AAA3223131) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RHOC Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RHOC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RHOC rhoc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVGNKKDLRQ DEHTRRELAK MKQEPVRSEE GRDMANRISA FGYLECSAKT. It is sometimes possible for the material contained within the vial of "RHOC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.