Western Blot (WB)
(Host: RabbitTarget Name: RHDSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Rabbit anti-Human RHD Polyclonal Antibody | anti-RHD antibody
RHD antibody - N-terminal region
Gene Names
RHD; RH; Rh4; RH30; RhII; RhPI; DIIIc; RHCED; RHDel; RHPII; RhDCw; CD240D; RHXIII; RHDVA(TT); RhK562-II
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RHD; Polyclonal Antibody; RHD antibody - N-terminal region; anti-RHD antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFL
Sequence Length
321
Applicable Applications for anti-RHD antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RHDSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RHDSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-RHD AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellRHD is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Western Blot (WB)
(WB Suggested Anti-RHD AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellRHD is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Related Product Information for anti-RHD antibody
This is a rabbit polyclonal antibody against RHD. It was validated on Western Blot
Target Description: The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene, which encodes the RhD protein, and a second gene that encodes both the RhC and RhE antigens on a single polypeptide. The two genes, and a third unrelated gene, are found in a cluster on chromosome 1. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. Multiple transcript variants encoding different isoforms have been found for this gene.
Target Description: The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene, which encodes the RhD protein, and a second gene that encodes both the RhC and RhE antigens on a single polypeptide. The two genes, and a third unrelated gene, are found in a cluster on chromosome 1. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-RHD antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35kDa
NCBI Official Full Name
blood group Rh(D) polypeptide isoform 2
NCBI Official Synonym Full Names
Rh blood group D antigen
NCBI Official Symbol
RHD
NCBI Official Synonym Symbols
RH; Rh4; RH30; RhII; RhPI; DIIIc; RHCED; RHDel; RHPII; RhDCw; CD240D; RHXIII; RHDVA(TT); RhK562-II
NCBI Protein Information
blood group Rh(D) polypeptide
NCBI Description
The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene, which encodes the RhD protein, and a second gene that encodes both the RhC and RhE antigens on a single polypeptide. The two genes, and a third unrelated gene, are found in a cluster on chromosome 1. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Research Articles on RHD
Similar Products
Product Notes
The RHD (Catalog #AAA3215874) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RHD antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RHD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RHD for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WALTLEAALI LLFYFFTHYD ASLEDQKGLV ASYQVGQDLT VMAAIGLGFL. It is sometimes possible for the material contained within the vial of "RHD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
