Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RHBDD3Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human RHBDD3 Polyclonal Antibody | anti-RHBDD3 antibody

RHBDD3 Antibody - C-terminal region

Gene Names
RHBDD3; PTAG; C22orf3; HS984G1A
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RHBDD3; Polyclonal Antibody; RHBDD3 Antibody - C-terminal region; anti-RHBDD3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GFPTEQAVVALAATGRVEGAVSLLVGGQVGTETLVTHGKGGPAHSEGPGP
Sequence Length
167
Applicable Applications for anti-RHBDD3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RHBDD3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RHBDD3Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RHBDD3Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)
Product Categories/Family for anti-RHBDD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
rhomboid domain-containing protein 3
NCBI Official Synonym Full Names
rhomboid domain containing 3
NCBI Official Symbol
RHBDD3
NCBI Official Synonym Symbols
PTAG; C22orf3; HS984G1A
NCBI Protein Information
rhomboid domain-containing protein 3
UniProt Protein Name
Rhomboid domain-containing protein 3
UniProt Gene Name
RHBDD3
UniProt Synonym Gene Names
C22orf3
UniProt Entry Name
RHBD3_HUMAN

Uniprot Description

RHBDD3:

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: integral to membrane

Molecular Function: serine-type endopeptidase activity

Biological Process: response to xenobiotic stimulus; regulation of protein secretion; regulation of acute inflammatory response; negative regulation of natural killer cell activation; positive regulation of protein catabolic process; MAPKKK cascade; proteolysis; liver development

Research Articles on RHBDD3

Similar Products

Product Notes

The RHBDD3 rhbdd3 (Catalog #AAA3220604) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RHBDD3 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RHBDD3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RHBDD3 rhbdd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GFPTEQAVVA LAATGRVEGA VSLLVGGQVG TETLVTHGKG GPAHSEGPGP. It is sometimes possible for the material contained within the vial of "RHBDD3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.