Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RHBDD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human kidney)

Rabbit RHBDD1 Polyclonal Antibody | anti-RHBDD1 antibody

RHBDD1 antibody - C-terminal region

Gene Names
RHBDD1; RRP4; RHBDL4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RHBDD1; Polyclonal Antibody; RHBDD1 antibody - C-terminal region; anti-RHBDD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLS
Sequence Length
315
Applicable Applications for anti-RHBDD1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Yeast: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RHBDD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RHBDD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human kidney)

Western Blot (WB) (WB Suggested Anti-RHBDD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human kidney)
Related Product Information for anti-RHBDD1 antibody
This is a rabbit polyclonal antibody against RHBDD1. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-RHBDD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
rhomboid-related protein 4
NCBI Official Synonym Full Names
rhomboid domain containing 1
NCBI Official Symbol
RHBDD1
NCBI Official Synonym Symbols
RRP4; RHBDL4
NCBI Protein Information
rhomboid-related protein 4
UniProt Protein Name
Rhomboid-related protein 4
Protein Family
UniProt Gene Name
RHBDD1
UniProt Synonym Gene Names
RHBDL4; RRP4
UniProt Entry Name
RHBL4_HUMAN

Uniprot Description

RHBDD1: Intramembrane-cleaving serine protease that cleaves single transmembrane or multi-pass membrane proteins in the hydrophobic plane of the membrane, luminal loops and juxtamembrane regions. Involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors. Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded membrane proteins. Required for the degradation process of some specific misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Functions in BIK, MPZ, PKD1, PTCRA, RHO, STEAP3 and TRAC processing. Involved in the regulation of exosomal secretion; inhibits the TSAP6-mediated secretion pathway. Involved in the regulation of apoptosis; modulates BIK-mediated apoptotic activity. Also plays a role in the regulation of spermatogenesis; inhibits apoptotic activity in spermatogonia. Belongs to the peptidase S54 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.21.105; Membrane protein, integral; Membrane protein, multi-pass; Protease

Chromosomal Location of Human Ortholog: 2q36.3

Cellular Component: endoplasmic reticulum membrane; mitochondrion; integral to endoplasmic reticulum membrane

Molecular Function: protein binding; serine-type endopeptidase activity; endopeptidase activity

Biological Process: spermatid differentiation; ER-associated protein catabolic process; membrane protein intracellular domain proteolysis; apoptosis; membrane protein proteolysis; positive regulation of protein catabolic process; positive regulation of secretion; post-translational protein modification; negative regulation of apoptosis

Research Articles on RHBDD1

Similar Products

Product Notes

The RHBDD1 rhbdd1 (Catalog #AAA3214820) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RHBDD1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's RHBDD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RHBDD1 rhbdd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PDHYEEAPRN YDTYTAGLSE EEQLERALQA SLWDRGNTRN SPPPYGFHLS. It is sometimes possible for the material contained within the vial of "RHBDD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.