Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.75kD).)

Mouse anti-Human CYP2J2 Monoclonal Antibody | anti-CYP2J2 antibody

CYP2J2 (Cytochrome P450 2J2, CYPIIJ2, Arachidonic Acid Epoxygenase) (AP)

Gene Names
CYP2J2; CPJ2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CYP2J2; Monoclonal Antibody; CYP2J2 (Cytochrome P450 2J2; CYPIIJ2; Arachidonic Acid Epoxygenase) (AP); anti-CYP2J2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D10
Specificity
Recognizes human CYP2J2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CYP2J2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa408-498 from human CYP2J2 (NP_000766) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.75kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.75kD).)

Testing Data

(Detection limit for recombinant GST tagged CYP2J2 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CYP2J2 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-CYP2J2 antibody
CYP2J2 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is thought to be the predominant enzyme responsible for epoxidation of endogenous arachidonic acid in cardiac tissue.
Product Categories/Family for anti-CYP2J2 antibody
References
1. Identifying a Selective Substrate and Inhibitor Pair for the Evaluation of CYP2J2 Activity. Lee CA, Jones JP 3rd, Katayama J, Kaspera R, Jiang Y, Freiwald S, Smith E, Walker GS, Totah RA.Drug Metab Dispos. 2012 May;40(5):943-51. Epub 2012 Feb 10. 2. Detection of EETs and HETEs-generating Cytochrome P450 Enzymes and the Effects of their Metabolites on Myometrial and Vascular Function. Pearson T, Warren AY, Barrett DA, Khan RN.Am J Physiol Endocrinol Metab. 2009 Sep;297(3):E647-56. Epub 2009 Jun 23.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,611 Da
NCBI Official Full Name
cytochrome P450 2J2
NCBI Official Synonym Full Names
cytochrome P450, family 2, subfamily J, polypeptide 2
NCBI Official Symbol
CYP2J2
NCBI Official Synonym Symbols
CPJ2
NCBI Protein Information
cytochrome P450 2J2; CYPIIJ2; arachidonic acid epoxygenase; cytochrome P450, subfamily IIJ (arachidonic acid epoxygenase) polypeptide 2; flavoprotein-linked monooxygenase; microsomal monooxygenase
UniProt Protein Name
Cytochrome P450 2J2
Protein Family
UniProt Gene Name
CYP2J2
UniProt Entry Name
CP2J2_HUMAN

Uniprot Description

CYP2J2: This enzyme metabolizes arachidonic acid predominantly via a NADPH-dependent olefin epoxidation to all four regioisomeric cis-epoxyeicosatrienoic acids. One of the predominant enzymes responsible for the epoxidation of endogenous cardiac arachidonic acid pools. Belongs to the cytochrome P450 family.

Protein type: Oxidoreductase; Lipid Metabolism - arachidonic acid; Contractile; Lipid Metabolism - linoleic acid; EC 1.14.14.1

Chromosomal Location of Human Ortholog: 1p31.3-p31.2

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle; cytoplasm

Molecular Function: arachidonic acid 14,15-epoxygenase activity; iron ion binding; arachidonic acid 11,12-epoxygenase activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen; heme binding; arachidonic acid epoxygenase activity; steroid hydroxylase activity; oxygen binding

Biological Process: xenobiotic metabolic process; icosanoid metabolic process; exogenous drug catabolic process; arachidonic acid metabolic process; linoleic acid metabolic process; epoxygenase P450 pathway; regulation of heart contraction

Similar Products

Product Notes

The CYP2J2 cyp2j2 (Catalog #AAA6130841) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CYP2J2 (Cytochrome P450 2J2, CYPIIJ2, Arachidonic Acid Epoxygenase) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP2J2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CYP2J2 cyp2j2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CYP2J2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.