Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RFC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)

Rabbit RFC1 Polyclonal Antibody | anti-RFC1 antibody

RFC1 antibody - middle region

Gene Names
RFC1; A1; RFC; PO-GA; RECC1; MHCBFB; RFC140
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RFC1; Polyclonal Antibody; RFC1 antibody - middle region; anti-RFC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLALHMSL
Sequence Length
1147
Applicable Applications for anti-RFC1 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RFC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RFC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-RFC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)
Related Product Information for anti-RFC1 antibody
This is a rabbit polyclonal antibody against RFC1. It was validated on Western Blot

Target Description: The protein encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
128kDa
NCBI Official Full Name
replication factor C subunit 1 isoform 1
NCBI Official Synonym Full Names
replication factor C subunit 1
NCBI Official Symbol
RFC1
NCBI Official Synonym Symbols
A1; RFC; PO-GA; RECC1; MHCBFB; RFC140
NCBI Protein Information
replication factor C subunit 1
UniProt Protein Name
Replication factor C subunit 1
Protein Family
UniProt Gene Name
RFC1
UniProt Synonym Gene Names
RFC140; A1 140 kDa subunit; RF-C 140 kDa subunit; RFC140
UniProt Entry Name
RFC1_HUMAN

NCBI Description

This gene encodes the large subunit of replication factor C, a five subunit DNA polymerase accessory protein, which is a DNA-dependent ATPase required for eukaryotic DNA replication and repair. The large subunit acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It may also have a role in telomere stability. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Mar 2011]

Uniprot Description

RFC1: a DNA binding protein that may play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA. The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and RFC1. The RFC1 subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Two alternatively spliced isoforms have been described.

Protein type: DNA replication

Chromosomal Location of Human Ortholog: 4p14-p13

Cellular Component: nucleoplasm; Golgi apparatus; DNA replication factor C complex; nucleolus; cell junction; nucleus

Molecular Function: protein domain specific binding; protein binding; DNA binding; sequence-specific DNA binding; enzyme activator activity; double-stranded DNA binding; ATP binding; DNA clamp loader activity

Biological Process: positive regulation of catalytic activity; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; telomere maintenance via telomerase; negative regulation of transcription from RNA polymerase II promoter; DNA strand elongation during DNA replication; DNA repair; telomere maintenance via semi-conservative replication; nucleotide-excision repair; transcription-coupled nucleotide-excision repair; telomere maintenance via recombination; nucleotide-excision repair, DNA gap filling; mitotic cell cycle; DNA-dependent DNA replication; telomere maintenance

Research Articles on RFC1

Similar Products

Product Notes

The RFC1 rfc1 (Catalog #AAA3212829) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RFC1 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RFC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RFC1 rfc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AQAIYASVLP GELMRGYMTQ FPTFPSWLGK HSSTGKHDRI VQDLALHMSL. It is sometimes possible for the material contained within the vial of "RFC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.