Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using REEP2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

Rabbit anti-Mouse, Rat REEP2 Polyclonal Antibody | anti-REEP2 antibody

REEP2 Rabbit pAb

Gene Names
REEP2; SPG72; C5orf19; SGC32445
Reactivity
Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity purification
Synonyms
REEP2; Polyclonal Antibody; REEP2 Rabbit pAb; C5orf19; SGC32445; SPG72; Yip2d; anti-REEP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
HPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA
Applicable Applications for anti-REEP2 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 93-252 of human REEP2 (NP_057690.2).
Positive Samples
RD, Mouse brain, Mouse testis, Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using REEP2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using REEP2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

Immunofluorescence (IF)

(Immunofluorescence analysis of rat brain using REEP2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of rat brain using REEP2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
Related Product Information for anti-REEP2 antibody
Background: This gene encodes a member of the receptor expression enhancing protein family. Studies of a related gene in mouse suggest that the encoded protein is found in the cell membrane and enhances the function of sweet taste receptors. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-REEP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
28,446 Da
NCBI Official Full Name
receptor accessory protein 2, isoform CRA_c
NCBI Official Synonym Full Names
receptor accessory protein 2
NCBI Official Symbol
REEP2
NCBI Official Synonym Symbols
SPG72; C5orf19; SGC32445
NCBI Protein Information
receptor expression-enhancing protein 2
UniProt Protein Name
Receptor expression-enhancing protein 2
UniProt Gene Name
REEP2
UniProt Synonym Gene Names
C5orf19; SGC32445
UniProt Entry Name
REEP2_HUMAN

NCBI Description

This gene encodes a member of the receptor expression enhancing protein family. Studies of a related gene in mouse suggest that the encoded protein is found in the cell membrane and enhances the function of sweet taste receptors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]

Uniprot Description

REEP2: May enhance the cell surface expression of odorant receptors. Belongs to the DP1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; integral to plasma membrane; cytoplasmic microtubule

Molecular Function: taste receptor binding

Biological Process: protein transport into lipid raft; sensory perception of sweet taste; regulation of intracellular transport; sensory perception of bitter taste

Disease: Spastic Paraplegia 72, Autosomal Recessive

Research Articles on REEP2

Similar Products

Product Notes

The REEP2 reep2 (Catalog #AAA9142636) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The REEP2 Rabbit pAb reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's REEP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:200. Researchers should empirically determine the suitability of the REEP2 reep2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HPTLSNKEKE IDEYITQARD KSYETMMRVG KRGLNLAANA AVTAAAKGVL SEKLRSFSMQ DLTLIRDEDA LPLQRPDGRL RPSPGSLLDT IEDLGDDPAL SLRSSTNPAD SRTEASEDDM GDKAPKRAKP IKKAPKAEPL ASKTLKTRPK KKTSGGGDSA. It is sometimes possible for the material contained within the vial of "REEP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.