<
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using CNNM1 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Rabbit CNNM1 Polyclonal Antibody | anti-CNNM1 antibody
CNNM1 Rabbit pAb
Gene Names
CNNM1; ACDP1; CLP-1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity purification
Synonyms
CNNM1; Polyclonal Antibody; CNNM1 Rabbit pAb; ACDP1; CLP-1; anti-CNNM1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
NGAFTYYGVPAIMTTACSDNDVRKVGSLAGSSVFLNRSPSRCSGLNRSESPNRERSDFGGSNTQLYSSSNNLYMPDYSVHILSDVQFVKITRQQYQNALTACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPAITLLNNRNSLPCSRSDGLRSPSEVVYLRMEELAFTQEEMTDFEEHSTQQLTLSPAAVPTRAASDSECCNINLDTETSPCSSDFEENVGKKLLRTLSGQKRKRSPEGERTSEDNSNLTPLIT
Applicable Applications for anti-CNNM1 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:100
IF: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 692-951 of human CNNM1 (NP_065081.2).
Positive Samples
Mouse brain, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using CNNM1 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using CNNM1 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Immunofluorescence (IF)
(Immunofluorescence analysis of C6 cells using CNNM1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Immunofluorescence (IF)
(Immunofluorescence analysis of C6 cells using CNNM1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Immunofluorescence (IF)
(Immunofluorescence analysis of L929 cells using CNNM1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Immunofluorescence (IF)
(Immunofluorescence analysis of L929 cells using CNNM1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Immunofluorescence (IF)
(Immunofluorescence analysis of U-2 OS cells using CNNM1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Immunofluorescence (IF)
(Immunofluorescence analysis of U-2 OS cells using CNNM1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Related Product Information for anti-CNNM1 antibody
Background: This gene encodes a member of the ancient conserved domain protein family. The encoded protein may bind copper. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-CNNM1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
104,351 Da
NCBI Official Full Name
metal transporter CNNM1
NCBI Official Synonym Full Names
cyclin and CBS domain divalent metal cation transport mediator 1
NCBI Official Symbol
CNNM1
NCBI Official Synonym Symbols
ACDP1; CLP-1
NCBI Protein Information
metal transporter CNNM1; cyclin M1; cyclin-M1; ancient conserved domain protein 1; ancient conserved domain-containing protein 1
UniProt Protein Name
Metal transporter CNNM1
Protein Family
UniProt Gene Name
CNNM1
UniProt Synonym Gene Names
ACDP1
UniProt Entry Name
CNNM1_HUMAN
Similar Products
Product Notes
The CNNM1 cnnm1 (Catalog #AAA9142625) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNNM1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CNNM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:100. Researchers should empirically determine the suitability of the CNNM1 cnnm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NGAFTYYGVP AIMTTACSDN DVRKVGSLAG SSVFLNRSPS RCSGLNRSES PNRERSDFGG SNTQLYSSSN NLYMPDYSVH ILSDVQFVKI TRQQYQNALT ACHMDSSPQS PDMEAFTDGD STKAPTTRGT PQTPKDDPAI TLLNNRNSLP CSRSDGLRSP SEVVYLRMEE LAFTQEEMTD FEEHSTQQLT LSPAAVPTRA ASDSECCNIN LDTETSPCSS DFEENVGKKL LRTLSGQKRK RSPEGERTSE DNSNLTPLIT. It is sometimes possible for the material contained within the vial of "CNNM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
