Western Blot (WB)
(WB Suggested Anti-RBP1 Antibody Titration: 2.5ug/mlPositive Control: HCT116 cell lysateRBP1 is supported by BioGPS gene expression data to be expressed in HCT116)
Rabbit RBP1 Polyclonal Antibody | anti-RBP1 antibody
RBP1 antibody - middle region
Gene Names
RBP1; CRBP; RBPC; CRBP1; CRBPI; CRABP-I
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
RBP1; Polyclonal Antibody; RBP1 antibody - middle region; anti-RBP1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG
Sequence Length
135
Applicable Applications for anti-RBP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RBP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RBP1 Antibody Titration: 2.5ug/mlPositive Control: HCT116 cell lysateRBP1 is supported by BioGPS gene expression data to be expressed in HCT116)
Western Blot (WB)
(WB Suggested Anti-RBP1 Antibody Titration: 2.5ug/mlPositive Control: HCT116 cell lysateRBP1 is supported by BioGPS gene expression data to be expressed in HCT116)
Related Product Information for anti-RBP1 antibody
This is a rabbit polyclonal antibody against RBP1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision.RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. The gene harbors four exons encoding 24, 59, 33, and 16 amino acid residues respectively. The second intervening sequence alone occupies 19 kb of the 21 kb of the gene.
Target Description: RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision.RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. The gene harbors four exons encoding 24, 59, 33, and 16 amino acid residues respectively. The second intervening sequence alone occupies 19 kb of the 21 kb of the gene.
Product Categories/Family for anti-RBP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
retinol-binding protein 1 isoform a
NCBI Official Synonym Full Names
retinol binding protein 1
NCBI Official Symbol
RBP1
NCBI Official Synonym Symbols
CRBP; RBPC; CRBP1; CRBPI; CRABP-I
NCBI Protein Information
retinol-binding protein 1
UniProt Protein Name
Retinol-binding protein 1
Protein Family
UniProt Gene Name
RBP1
UniProt Synonym Gene Names
CRBP1; CRBP; CRBP-I
UniProt Entry Name
RET1_HUMAN
NCBI Description
This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
Uniprot Description
RBP1: Intracellular transport of retinol. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Chromosomal Location of Human Ortholog: 3q23
Cellular Component: cytosol
Molecular Function: retinoid binding; transporter activity; retinal binding; retinol binding
Biological Process: phototransduction, visible light; transport; retinoid metabolic process; vitamin A metabolic process
Research Articles on RBP1
Similar Products
Product Notes
The RBP1 rbp1 (Catalog #AAA3206183) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBP1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RBP1 rbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IIRTLSTFRN YIMDFQVGKE FEEDLTGIDD RKCMTTVSWD GDKLQCVQKG. It is sometimes possible for the material contained within the vial of "RBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
