Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ARFGAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Rabbit anti-Dog, Human ARFGAP1 Polyclonal Antibody | anti-ARFGAP1 antibody

ARFGAP1 antibody - middle region

Gene Names
ARFGAP1; ARF1GAP; HRIHFB2281
Reactivity
Dog, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARFGAP1; Polyclonal Antibody; ARFGAP1 antibody - middle region; anti-ARFGAP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WRDVTTFFSGKAEGPLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAE
Sequence Length
406
Applicable Applications for anti-ARFGAP1 antibody
Western Blot (WB)
Homology
Dog: 83%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARFGAP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ARFGAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-ARFGAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Related Product Information for anti-ARFGAP1 antibody
This is a rabbit polyclonal antibody against ARFGAP1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a GTPase-activating protein (GAP) which associates with the Golgi apparatus and which interacts with ADP-ribosylation factor 1 (ARF1). The encoded protein promotes hydrolysis of ARF1-bound GTP and is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is required for the fusion of these vesicles with target compartments. The activity of this protein is stimulated by phosphoinosides and inhibited by phosphatidylcholine. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-ARFGAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
ADP-ribosylation factor GTPase-activating protein 1 isoform a
NCBI Official Synonym Full Names
ADP ribosylation factor GTPase activating protein 1
NCBI Official Symbol
ARFGAP1
NCBI Official Synonym Symbols
ARF1GAP; HRIHFB2281
NCBI Protein Information
ADP-ribosylation factor GTPase-activating protein 1
UniProt Protein Name
ADP-ribosylation factor GTPase-activating protein 1
UniProt Gene Name
ARFGAP1
UniProt Synonym Gene Names
ARF1GAP; ARF GAP 1; ARF1 GAP
UniProt Entry Name
ARFG1_HUMAN

NCBI Description

The protein encoded by this gene is a GTPase-activating protein, which associates with the Golgi apparatus and which interacts with ADP-ribosylation factor 1. The encoded protein promotes hydrolysis of ADP-ribosylation factor 1-bound GTP and is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is required for the fusion of these vesicles with target compartments. The activity of this protein is stimulated by phosphoinosides and inhibited by phosphatidylcholine. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

ARF GAP1: GTPase-activating protein (GAP) for the ADP ribosylation factor 1 (ARF1). Involved in membrane trafficking and /or vesicle transport. Promotes hydrolysis of the ARF1-bound GTP and thus, is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles, a prerequisite for vesicle's fusion with target compartment. Probably regulates ARF1-mediated transport via its interaction with the KDELR proteins and TMED2. Overexpression induces the redistribution of the entire Golgi complex to the endoplasmic reticulum, as when ARF1 is deactivated. Its activity is stimulated by phosphoinosides and inhibited by phosphatidylcholine. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs, ARF; GAPs; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: synapse; cytosol

Molecular Function: protein binding; zinc ion binding; GTPase activator activity

Biological Process: protein transport; unfolded protein response, activation of signaling protein activity; COPI coating of Golgi vesicle; cellular protein metabolic process; unfolded protein response; retrograde vesicle-mediated transport, Golgi to ER; positive regulation of GTPase activity

Research Articles on ARFGAP1

Similar Products

Product Notes

The ARFGAP1 arfgap1 (Catalog #AAA3213200) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARFGAP1 antibody - middle region reacts with Dog, Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARFGAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARFGAP1 arfgap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WRDVTTFFSG KAEGPLDSPS EGHSYQNSGL DHFQNSNIDQ SFWETFGSAE. It is sometimes possible for the material contained within the vial of "ARFGAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.