Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-RBMY1F Polyclonal Antibody)

Rabbit anti-Rat RBMY1F Polyclonal Antibody | anti-RBMY1F antibody

RBMY1F Polyclonal Antibody

Gene Names
RBMY1F; YRRM2
Reactivity
Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
RBMY1F; Polyclonal Antibody; RBMY1F Polyclonal Antibody; YRRM2; RNA binding motif protein; Y-linked; family 1; member F; anti-RBMY1F antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.27 mg/ml (varies by lot)
Sequence Length
496
Applicable Applications for anti-RBMY1F antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human RBMY1F (NP_689798.1).
Immunogen Sequence
MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNGTSLHGKAIKV
Positive Samples
Rat Kidney
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-RBMY1F Polyclonal Antibody)

Western Blot (WB) (Western blot-RBMY1F Polyclonal Antibody)
Related Product Information for anti-RBMY1F antibody
This gene encodes a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. Multiple copies of this gene are found in the AZFb azoospermia factor region of chromosome Y and the encoded protein is thought to be involved in spermatogenesis. Most copies of this locus are pseudogenes, although six highly similar copies have full-length ORFs and are considered functional. Four functional copies of this gene are found within inverted repeat IR2; two functional copies of this gene are found in palindrome P3, along with two copies of PTPN13-like, Y-linked.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 47kDa; 55kDa
Observed: 56kDa
NCBI Official Full Name
RNA-binding motif protein, Y chromosome, family 1 member F/J
NCBI Official Synonym Full Names
RNA binding motif protein, Y-linked, family 1, member F
NCBI Official Symbol
RBMY1F
NCBI Official Synonym Symbols
YRRM2
NCBI Protein Information
RNA-binding motif protein, Y chromosome, family 1 member F/J
UniProt Protein Name
RNA-binding motif protein, Y chromosome, family 1 member F/J
Protein Family
UniProt Gene Name
RBMY1F
UniProt Synonym Gene Names
YRRM2
UniProt Entry Name
RBY1F_HUMAN

NCBI Description

This gene encodes a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. Multiple copies of this gene are found in the AZFb azoospermia factor region of chromosome Y and the encoded protein is thought to be involved in spermatogenesis. Most copies of this locus are pseudogenes, although six highly similar copies have full-length ORFs and are considered functional. Four functional copies of this gene are found within inverted repeat IR2; two functional copies of this gene are found in palindrome P3, along with two copies of PTPN13-like, Y-linked. [provided by RefSeq, Jul 2008]

Uniprot Description

RBMY1F: RNA-binding protein which may be involved in spermatogenesis. Required for sperm development, possibly by participating in pre-mRNA splicing in the testis. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: Yq11.223

Cellular Component: nucleus

Molecular Function: nucleotide binding; protein binding; RNA binding

Biological Process: mRNA processing; RNA splicing; spermatogenesis

Similar Products

Product Notes

The RBMY1F rbmy1f (Catalog #AAA9140941) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBMY1F Polyclonal Antibody reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RBMY1F can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the RBMY1F rbmy1f for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBMY1F, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.