Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RASGRP1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human RASGRP1 Polyclonal Antibody | anti-RASGRP1 antibody

RASGRP1 Antibody - middle region

Gene Names
RASGRP1; RASGRP; CALDAG-GEFI; CALDAG-GEFII
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RASGRP1; Polyclonal Antibody; RASGRP1 Antibody - middle region; anti-RASGRP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTD
Sequence Length
797
Applicable Applications for anti-RASGRP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RASGRP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RASGRP1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RASGRP1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RASGRP1 antibody
This gene is a member of a family of genes characterized by the presence of a Ras superfamily guanine nucleotide exchange factor (GEF) domain. It functions as a diacylglycerol (DAG)-regulated nucleotide exchange factor specifically activating Ras through the exchange of bound GDP for GTP. It activates the Erk/MAP kinase cascade and regulates T-cells and B-cells development, homeostasis and differentiation. Alternatively spliced transcript variants encoding different isoforms have been identified. Altered expression of the different isoforms of this protein may be a cause of susceptibility to systemic lupus erythematosus (SLE).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87 kDa
NCBI Official Full Name
RAS guanyl-releasing protein 1 isoform b
NCBI Official Synonym Full Names
RAS guanyl releasing protein 1
NCBI Official Symbol
RASGRP1
NCBI Official Synonym Symbols
RASGRP; CALDAG-GEFI; CALDAG-GEFII
NCBI Protein Information
RAS guanyl-releasing protein 1
UniProt Protein Name
RAS guanyl-releasing protein 1
UniProt Gene Name
RASGRP1
UniProt Synonym Gene Names
RASGRP; CalDAG-GEFII
UniProt Entry Name
GRP1_HUMAN

NCBI Description

This gene is a member of a family of genes characterized by the presence of a Ras superfamily guanine nucleotide exchange factor (GEF) domain. It functions as a diacylglycerol (DAG)-regulated nucleotide exchange factor specifically activating Ras through the exchange of bound GDP for GTP. It activates the Erk/MAP kinase cascade and regulates T-cells and B-cells development, homeostasis and differentiation. Alternatively spliced transcript variants encoding different isoforms have been identified. Altered expression of the different isoforms of this protein may be a cause of susceptibility to systemic lupus erythematosus (SLE). [provided by RefSeq, Jul 2008]

Uniprot Description

RASGRP1: Functions as a diacylglycerol (DAG)-regulated nucleotide exchange factor specifically activating Ras through the exchange of bound GDP for GTP. Activates the Erk/MAP kinase cascade. Couples T-lymphocytes and B-lymphocytes antigen receptors to the activation of Ras. Hence, regulates T-cells and B-cells development, homeostasis and differentiation. Functions also in FcERI-evoked degranulation and cytokine secretion by mast cells, regulating allergic responses. May also function in other cell types differentiation. Defects in RASGRP1 may contribute to susceptibility to systemic lupus erythematosus (SLE). SLE is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. SLE is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Aberrantly spliced isoforms and/or diminished levels of RASGRP1 are found in a cohort of SLE patients raising the possibility that dysregulation of this signaling protein contributes to the development of autoimmunity in a subset of SLE patients. Belongs to the RASGRP family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs, Ras; GEFs

Chromosomal Location of Human Ortholog: 15q14

Cellular Component: Golgi membrane; endoplasmic reticulum membrane; mast cell granule; membrane; plasma membrane; cytosol

Molecular Function: guanyl-nucleotide exchange factor activity; calcium ion binding; lipid binding

Biological Process: platelet activation; inflammatory response to antigenic stimulus; Ras protein signal transduction; regulation of phosphoinositide 3-kinase cascade; vesicle transport along microtubule; innate immune response; cytokine production; mast cell degranulation; blood coagulation; signal transduction; cell differentiation; secretory granule localization

Research Articles on RASGRP1

Similar Products

Product Notes

The RASGRP1 rasgrp1 (Catalog #AAA3221646) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RASGRP1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RASGRP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RASGRP1 rasgrp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLCHSSISRL KETSSHVPHE INKVLGEMTE LLSSSRNYDN YRRAYGECTD. It is sometimes possible for the material contained within the vial of "RASGRP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.