Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RASGRF1Sample Type: HepG2 Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit RASGRF1 Polyclonal Antibody | anti-RASGRF1 antibody

RASGRF1 antibody - N-terminal region

Gene Names
RASGRF1; GNRP; GRF1; CDC25; GRF55; CDC25L; H-GRF55; PP13187; ras-GRF1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RASGRF1; Polyclonal Antibody; RASGRF1 antibody - N-terminal region; anti-RASGRF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Specificity
Predicted to recognized both human RASGRF1 isoforms (145, 55kD)
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG
Sequence Length
489
Applicable Applications for anti-RASGRF1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 85%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RASGRF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RASGRF1Sample Type: HepG2 Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RASGRF1Sample Type: HepG2 Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: RASGRF1Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RASGRF1Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: RASGRF1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RASGRF1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: RASGRF1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RASGRF1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: RASGRF1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RASGRF1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RASGRF1 antibody
This is a rabbit polyclonal antibody against RASGRF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated that this protein stimulates the dissociation of GDP from RAS protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
ras-specific guanine nucleotide-releasing factor 1 isoform 2
NCBI Official Synonym Full Names
Ras protein specific guanine nucleotide releasing factor 1
NCBI Official Symbol
RASGRF1
NCBI Official Synonym Symbols
GNRP; GRF1; CDC25; GRF55; CDC25L; H-GRF55; PP13187; ras-GRF1
NCBI Protein Information
ras-specific guanine nucleotide-releasing factor 1
UniProt Protein Name
Ras-specific guanine nucleotide-releasing factor 1
UniProt Gene Name
RASGRF1
UniProt Synonym Gene Names
CDC25; GNRP; GRF1; Ras-GRF1; GNRP
UniProt Entry Name
RGRF1_HUMAN

NCBI Description

The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated that this protein stimulates the dissociation of GDP from RAS protein. The studies of the similar gene in mouse suggested that the Ras-GEF activity of this protein in brain can be activated by Ca2+ influx, muscarinic receptors, and G protein beta-gamma subunit. Mouse studies also indicated that the Ras-GEF signaling pathway mediated by this protein may be important for long-term memory. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Mar 2009]

Uniprot Description

RASGRF1: a guanine nucleotide exchange factor (GEF). Stimulates the dissociation of GDP from RAS protein. Activated by Ca2+ influx, muscarinic receptors, and G protein beta-gamma subunit in the mouse brain,. The signaling pathway mediated by this protein may be important for long-term memory. Two alternatively spliced variants have been reported.

Protein type: GEFs, Ras; GEFs

Chromosomal Location of Human Ortholog: 15q24.2

Cellular Component: neuron projection; growth cone; plasma membrane; cytosol

Molecular Function: glutamate receptor binding; Rho guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; Ras guanyl-nucleotide exchange factor activity

Biological Process: regulation of Ras protein signal transduction; synaptic transmission; regulation of Rac protein signal transduction; cell proliferation; long-term memory; small GTPase mediated signal transduction; regulation of synaptic plasticity; positive regulation of Ras protein signal transduction; signal transduction; neurite development; regulation of neuronal synaptic plasticity

Research Articles on RASGRF1

Similar Products

Product Notes

The RASGRF1 rasgrf1 (Catalog #AAA3212823) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RASGRF1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RASGRF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RASGRF1 rasgrf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RELDNNRSAL SAASAFAIAT AGANEGTPNK EKYRRMSLAS AGFPPDQRNG. It is sometimes possible for the material contained within the vial of "RASGRF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.