Western Blot (WB)
(WB Suggested Anti-RAB9B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: U937 cell lysate)
Rabbit RAB9B Polyclonal Antibody | anti-RAB9B antibody
RAB9B antibody - N-terminal region
Gene Names
RAB9B; RAB9L; Rab-9L
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAB9B; Polyclonal Antibody; RAB9B antibody - N-terminal region; anti-RAB9B antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERF
Sequence Length
201
Applicable Applications for anti-RAB9B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RAB9B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RAB9B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: U937 cell lysate)
Western Blot (WB)
(WB Suggested Anti-RAB9B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: U937 cell lysate)
Related Product Information for anti-RAB9B antibody
This is a rabbit polyclonal antibody against RAB9B. It was validated on Western Blot
Target Description: This gene encodes a member of a subfamily of RAS small guanosine triphosphate (GTP)-binding proteins that regulate membrane trafficking. The encoded protein may be involved in endosome-to-Golgi transport.
Target Description: This gene encodes a member of a subfamily of RAS small guanosine triphosphate (GTP)-binding proteins that regulate membrane trafficking. The encoded protein may be involved in endosome-to-Golgi transport.
Product Categories/Family for anti-RAB9B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
ras-related protein Rab-9B
NCBI Official Synonym Full Names
RAB9B, member RAS oncogene family
NCBI Official Symbol
RAB9B
NCBI Official Synonym Symbols
RAB9L; Rab-9L
NCBI Protein Information
ras-related protein Rab-9B
UniProt Protein Name
Ras-related protein Rab-9B
Protein Family
UniProt Gene Name
RAB9B
UniProt Synonym Gene Names
RAB9L; Rab-9L
UniProt Entry Name
RAB9B_HUMAN
NCBI Description
This gene encodes a member of a subfamily of RAS small guanosine triphosphate (GTP)-binding proteins that regulate membrane trafficking. The encoded protein may be involved in endosome-to-Golgi transport. [provided by RefSeq, Jan 2010]
Uniprot Description
Function: Involved in the transport of proteins between the endosomes and the trans Golgi network
By similarity.
Subcellular location: Cell membrane; Lipid-anchor; Cytoplasmic side
Potential. Cytoplasmic vesicle › phagosome. Cytoplasmic vesicle › phagosome membrane; Lipid-anchor; Cytoplasmic side
By similarity. Note: Recruited to phagosomes containing S.aureus or M.tuberculosis. Ref.5
Tissue specificity: Ubiquitous. Ref.1
Sequence similarities: Belongs to the small GTPase superfamily. Rab family.
Similar Products
Product Notes
The RAB9B rab9b (Catalog #AAA3213064) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB9B antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RAB9B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAB9B rab9b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KSSLMNRYVT NKFDSQAFHT IGVEFLNRDL EVDGRFVTLQ IWDTAGQERF. It is sometimes possible for the material contained within the vial of "RAB9B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
