Western Blot (WB)
(WB Suggested Anti-Tcn2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Pancreas)
Rabbit Tcn2 Polyclonal Antibody | anti-TCN2 antibody
Tcn2 antibody - N-terminal region
Gene Names
Tcn2; Tcn-2; AW208754
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Tcn2; Polyclonal Antibody; Tcn2 antibody - N-terminal region; anti-TCN2 antibody
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PWMDRLSSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTS
Sequence Length
430
Applicable Applications for anti-TCN2 antibody
Western Blot (WB)
Homology
Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Tcn2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Pancreas)
Western Blot (WB)
(WB Suggested Anti-Tcn2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Pancreas)
Related Product Information for anti-TCN2 antibody
This is a rabbit polyclonal antibody against Tcn2. It was validated on Western Blot
Target Description: Tcn2 is a primary vitamin B12-binding and transport protein. It delivers cobalamin to cells.
Target Description: Tcn2 is a primary vitamin B12-binding and transport protein. It delivers cobalamin to cells.
Product Categories/Family for anti-TCN2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
transcobalamin-2
NCBI Official Synonym Full Names
transcobalamin 2
NCBI Official Symbol
Tcn2
NCBI Official Synonym Symbols
Tcn-2; AW208754
NCBI Protein Information
transcobalamin-2
UniProt Protein Name
Transcobalamin-2
Protein Family
UniProt Gene Name
Tcn2
UniProt Synonym Gene Names
TC-2; TC II; TCII
UniProt Entry Name
TCO2_MOUSE
Uniprot Description
TCN2: Primary vitamin B12-binding and transport protein. Delivers cobalamin to cells. Defects in TCN2 are the cause of transcobalamin II deficiency (TCN2 deficiency). This results in various forms of anemia. Belongs to the eukaryotic cobalamin transport proteins family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Secreted, signal peptide; Secreted
Cellular Component: extracellular space; extracellular region
Molecular Function: metal ion binding; cobalamin binding
Biological Process: cobalamin metabolic process; transport; cobalamin transport; ion transport; cobalt ion transport
Similar Products
Product Notes
The TCN2 tcn2 (Catalog #AAA3208875) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tcn2 antibody - N-terminal region reacts with Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Tcn2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TCN2 tcn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PWMDRLSSEQ LNPSVFVGLR LSSMQAGTKE DLYLHSLKIH YQQCLLRSTS. It is sometimes possible for the material contained within the vial of "Tcn2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
