Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RAB2B AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)

Rabbit RAB2B Polyclonal Antibody | anti-RAB2B antibody

RAB2B antibody - C-terminal region

Reactivity
Dog, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAB2B; Polyclonal Antibody; RAB2B antibody - C-terminal region; anti-RAB2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGS
Sequence Length
216
Applicable Applications for anti-RAB2B antibody
Western Blot (WB)
Homology
Dog: 79%; Human: 100%; Pig: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RAB2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RAB2B AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)

Western Blot (WB) (WB Suggested Anti-RAB2B AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)
Related Product Information for anti-RAB2B antibody
This is a rabbit polyclonal antibody against RAB2B. It was validated on Western Blot

Target Description: Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking.
Product Categories/Family for anti-RAB2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
ras-related protein Rab-2B isoform 1
NCBI Official Synonym Full Names
RAB2B, member RAS oncogene family
NCBI Official Symbol
RAB2B
NCBI Protein Information
ras-related protein Rab-2B
UniProt Protein Name
Ras-related protein Rab-2B
Protein Family
UniProt Gene Name
RAB2B
UniProt Entry Name
RAB2B_HUMAN

NCBI Description

Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking; see MIM 179508.[supplied by OMIM, Apr 2006]

Uniprot Description

RAB2B: Required for protein transport from the endoplasmic reticulum to the Golgi complex (Potential). Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein, monomeric; G protein, monomeric, Rab; G protein

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: Golgi membrane; endoplasmic reticulum membrane; plasma membrane

Molecular Function: GTPase activity; GDP binding; GTP binding

Biological Process: vesicle-mediated transport; intracellular protein transport; metabolic process; Rab protein signal transduction; positive regulation of exocytosis

Research Articles on RAB2B

Similar Products

Product Notes

The RAB2B rab2b (Catalog #AAA3214906) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB2B antibody - C-terminal region reacts with Dog, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's RAB2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAB2B rab2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NTAKEIYRKI QQGLFDVHNE ANGIKIGPQQ SISTSVGPSA SQRNSRDIGS. It is sometimes possible for the material contained within the vial of "RAB2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.