Rabbit anti-Mouse, Rat PVRL4 Polyclonal Antibody | anti-PVRL4 antibody

PVRL4 Polyclonal Antibody

Cat. Num. AAA9140747

• Gene Names: NECTIN4; LNIR; PRR4; EDSS1; PVRL4; nectin-4
• Reactivity: Mouse, Rat
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: PVRL4; Polyclonal Antibody; PVRL4 Polyclonal Antibody; NECTIN4; EDSS1; LNIR; PRR4; nectin-4; anti-PVRL4 antibody

• Host: Rabbit
• Reactivity: Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 1.74 mg/ml (varies by lot)
• Sequence Length: 510

• Applicable Applications for anti-PVRL4 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 371-510 of human PVRL4 (NP_112178.2).
• Immunogen Sequence: MSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEESVGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGSGRAEEEEDQDEGIKQAMNHFVQENGTLRAKPTGNGIYINGRGHLV
• Positive Samples: Mouse Lung, Rat Brain
• Cellular Location: Cell Junction, Cell Membrane, Secreted, Single-Pass Type I Membrane Protein, Adherens Junction
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-PVRL4 Polyclonal Antibody)

Related Product Information for anti-PVRL4 antibody

This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.

NCBI and Uniprot Product Information

• NCBI GI #: 222136611
• NCBI GeneID: 81607
• NCBI Accession #: NP_112178.2
• NCBI GenBank Nucleotide #: NP_112178.2
• UniProt Accession #: Q96NY8
• Molecular Weight: Calculated: 24kDa; 55kDa; Observed: 55kDa
• NCBI Official Full Name: nectin-4
• NCBI Official Synonym Full Names: nectin cell adhesion molecule 4
• NCBI Official Symbol: NECTIN4
• NCBI Official Synonym Symbols: LNIR; PRR4; EDSS1; PVRL4; nectin-4
• NCBI Protein Information: nectin-4
• UniProt Protein Name: Poliovirus receptor-related protein 4
• UniProt Gene Name: PVRL4
• UniProt Synonym Gene Names: LNIR; PRR4
• UniProt Entry Name: PVRL4_HUMAN

NCBI Description

This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.[provided by RefSeq, Jan 2011]

Uniprot Description

nectin 4: Seems to be involved in cell adhesion through trans- homophilic and -heterophilic interactions, the latter including specifically interactions with PVRL2/nectin-1. Does not act as receptor for alpha-herpesvirus entry into cells. Defects in PVRL4 are the cause of ectodermal dysplasia- syndactyly syndrome type 1 (EDSS1). EDSS1 is a form of ectodermal dysplasia, a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. EDSS1 is characterized by the association of hair and teeth abnormalities with cutaneous syndactyly of the hands and/or feet. Hair morphologic abnormalities include twists at irregular intervals (pilli torti) and swelling along the shafts, particularly associated with areas of breakage. Dental findings consist of abnormally widely spaced teeth, with peg-shaped and conical crowns. Patients have normal sweating. Belongs to the nectin family.

Protein type: Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 1q23.3

Cellular Component: adherens junction; plasma membrane; integral to membrane

Molecular Function: protein binding

Biological Process: intercellular junction assembly and maintenance; viral reproduction; cell adhesion

Disease: Ectodermal Dysplasia-syndactyly Syndrome 1