Rabbit anti-Human Nectin-4/PVRL4 Polyclonal Antibody | anti-NECTIN4 antibody

Anti-Nectin-4/PVRL4 Antibody

Cat. Num. AAA178847

• Gene Names: NECTIN4; LNIR; PRR4; EDSS1; PVRL4; nectin-4
• Reactivity: Human
• Applications: Western Blot
• Purity: Immunogen affinity purified.
• Synonyms: Nectin-4/PVRL4; Polyclonal Antibody; Anti-Nectin-4/PVRL4 Antibody; EDSS1; Nectin 4; Nectin-4; PRR4; pvrl4; Q96NY8; nectin cell adhesion molecule 4; anti-NECTIN4 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 510

• Applicable Applications for anti-NECTIN4 antibody: Western Blot (WB)
• Application Notes: Western Blot: 0.1-0.5ug/ml
• Notes: Tested Species: In-house tested species with positive results.; Other applications have not been tested.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Nectin-4/PVRL4 (53-94aa FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGL HVSPAY), different from the related mouse sequence by seven amino acids.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of Nectin-4/PVRL4 expression in MCF-7 whole cell lysates (lane 1) and MM453 whole cell lysates (lane 2). Nectin-4/PVRL4 at 66KD was detected using rabbit anti- Nectin-4/PVRL4 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Related Product Information for anti-NECTIN4 antibody

Rabbit IgG polyclonal antibody for Nectin-4(NECTIN4) detection.
Background: PVRL4, also known as Nectin-4, is expressed in human skin, hair follicles, and cultured keratinocytes, but not in fibroblasts. This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.

References

1. Brancati, F., Fortugno, P., Bottillo, I., Lopez, M., Josselin, E., Boudghene-Stambouli, O., Agolini, E., Bernardini, L., Bellacchio, E., Iannicelli, M., Rossi, A., Dib-Lachachi, A., Stuppia, L., Palka, G., Mundlos, S., Stricker, S., Kornak, U., Zambruno, G., Dallapiccola, B.Mutations in PVRL4, encoding cell adhesion molecule nectin-4, cause ectodermal dysplasia-syndactyly syndrome.Am. J. Hum. Genet. 87: 265-273, 2010.
2. Fabre-Lafay, S., Garrido-Urbani, S., Reymond, N., Goncalves, A., Dubreuil, P., Lopez, M. Nectin-4, a new serological breast cancer marker, is a substrate for tumor necrosis factor-alpha-converting enzyme (TACE)/ADAM-17. J. Biol. Chem. 280: 19543-19550, 2005.
3. Muhlebach, M. D., Mateo, M., Sinn, P. L., Prufer, S., Uhlig, K. M., Leonard, V. H. J., Navaratnarajah, C. K., Frenzke, M., Wong, X. X., Sawatsky, B., Ramachandran, S., McCray, P. B., Jr., Cichutek, K., von Messling, V., Lopez, M., Cattaneo, R. Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Nature 480: 530-533, 2011.

NCBI and Uniprot Product Information

• NCBI GI #: 222136611
• NCBI GeneID: 81607
• NCBI Accession #: NP_112178.2
• NCBI GenBank Nucleotide #: NM_030916.2
• UniProt Accession #: Q96NY8; Q96K15; B4DQW3
• Molecular Weight: 24,341 Da
• NCBI Official Full Name: nectin-4
• NCBI Official Synonym Full Names: nectin cell adhesion molecule 4
• NCBI Official Symbol: NECTIN4
• NCBI Official Synonym Symbols: LNIR; PRR4; EDSS1; PVRL4; nectin-4
• NCBI Protein Information: nectin-4
• UniProt Protein Name: Nectin-4
• Protein Family: Nectin
• UniProt Gene Name: NECTIN4

NCBI Description

This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.[provided by RefSeq, Jan 2011]

Uniprot Description

Seems to be involved in cell adhesion through trans-homophilic and -heterophilic interactions, the latter including specifically interactions with NECTIN1. Does not act as receptor for alpha-herpesvirus entry into cells.(Microbial infection) Acts as a receptor for measles virus.