Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ALDH3A1Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ALDH3A1 Polyclonal Antibody | anti-ALDH3A1 antibody

ALDH3A1 Antibody - C-terminal region

Gene Names
ALDH3A1; ALDH3; ALDHIII
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ALDH3A1; Polyclonal Antibody; ALDH3A1 Antibody - C-terminal region; anti-ALDH3A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFETFSHRRSCLVR
Sequence Length
453
Applicable Applications for anti-ALDH3A1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ALDH3A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ALDH3A1Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ALDH3A1Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ALDH3A1 antibody
Aldehyde dehydrogenases oxidize various aldehydes to the corresponding acids. They are involved in the detoxification of alcohol-derived acetaldehyde and in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. The enzyme encoded by this gene forms a cytoplasmic homodimer that preferentially oxidizes aromatic and medium-chain (6 carbons or more) saturated and unsaturated aldehyde substrates. It is thought to promote resistance to UV and 4-hydroxy-2-nonenal-induced oxidative damage in the cornea. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Product Categories/Family for anti-ALDH3A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
218
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Full Name
aldehyde dehydrogenase, dimeric NADP-preferring isoform 1
NCBI Official Synonym Full Names
aldehyde dehydrogenase 3 family member A1
NCBI Official Symbol
ALDH3A1
NCBI Official Synonym Symbols
ALDH3; ALDHIII
NCBI Protein Information
aldehyde dehydrogenase, dimeric NADP-preferring
UniProt Protein Name
Aldehyde dehydrogenase, dimeric NADP-preferring
Protein Family
UniProt Gene Name
ALDH3A1
UniProt Synonym Gene Names
ALDH3
UniProt Entry Name
AL3A1_HUMAN

NCBI Description

Aldehyde dehydrogenases oxidize various aldehydes to the corresponding acids. They are involved in the detoxification of alcohol-derived acetaldehyde and in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. The enzyme encoded by this gene forms a cytoplasmic homodimer that preferentially oxidizes aromatic and medium-chain (6 carbons or more) saturated and unsaturated aldehyde substrates. It is thought to promote resistance to UV and 4-hydroxy-2-nonenal-induced oxidative damage in the cornea. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Sep 2008]

Uniprot Description

ALDH3A1: ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. This protein preferentially oxidizes aromatic aldehyde substrates. It may play a role in the oxidation of toxic aldehydes. Belongs to the aldehyde dehydrogenase family.

Protein type: Xenobiotic Metabolism - drug metabolism - cytochrome P450; Amino Acid Metabolism - histidine; Oxidoreductase; EC 1.2.1.5; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Amino Acid Metabolism - phenylalanine; Amino Acid Metabolism - tyrosine; Xenobiotic Metabolism - metabolism by cytochrome P450

Chromosomal Location of Human Ortholog: 17p11.2

Cellular Component: nucleoplasm; extracellular space; intracellular membrane-bound organelle; endoplasmic reticulum; cytoplasm; plasma membrane; cytosol

Molecular Function: aldehyde dehydrogenase (NAD) activity; aldehyde dehydrogenase [NAD(P)+] activity; 3-chloroallyl aldehyde dehydrogenase activity; alcohol dehydrogenase (NADP+) activity

Biological Process: response to drug; response to cAMP; positive regulation of cell proliferation; response to glucocorticoid stimulus; response to hypoxia; aldehyde metabolic process; response to nutrient; aging

Research Articles on ALDH3A1

Similar Products

Product Notes

The ALDH3A1 aldh3a1 (Catalog #AAA3222380) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALDH3A1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALDH3A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ALDH3A1 aldh3a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSGGVAANDV IVHITLHSLP FGGVGNSGMG SYHGKKSFET FSHRRSCLVR. It is sometimes possible for the material contained within the vial of "ALDH3A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.