Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PTDSR Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)

Rabbit PTDSR Polyclonal Antibody | anti-JMJD6 antibody

PTDSR antibody - C-terminal region

Gene Names
JMJD6; PSR; PTDSR; PTDSR1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
PTDSR; Polyclonal Antibody; PTDSR antibody - C-terminal region; anti-JMJD6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSD
Sequence Length
372
Applicable Applications for anti-JMJD6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PTDSR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PTDSR Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)

Western Blot (WB) (WB Suggested Anti-PTDSR Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)
Related Product Information for anti-JMJD6 antibody
This is a rabbit polyclonal antibody against PTDSR. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PTDSR is required during embryogenesis and differentiation of multiple organs during embryogenesis. PTDSR probably acts as a key regulator of hematopoietic differentiation. PTDSR may not be required for apoptotic cell clearance by macrophages but seems to be necessary for the regulation of macrophage cytokine responses

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 isoform 2
NCBI Official Synonym Full Names
jumonji domain containing 6, arginine demethylase and lysine hydroxylase
NCBI Official Symbol
JMJD6
NCBI Official Synonym Symbols
PSR; PTDSR; PTDSR1
NCBI Protein Information
bifunctional arginine demethylase and lysyl-hydroxylase JMJD6
UniProt Protein Name
Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6
UniProt Gene Name
JMJD6
UniProt Synonym Gene Names
KIAA0585; PTDSR; Protein PTDSR
UniProt Entry Name
JMJD6_HUMAN

NCBI Description

This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Research Articles on JMJD6

Similar Products

Product Notes

The JMJD6 jmjd6 (Catalog #AAA3204477) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTDSR antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PTDSR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the JMJD6 jmjd6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VVWHKTVRGR PKLSRKWYRI LKQEHPELAV LADSVDLQES TGIASDSSSD. It is sometimes possible for the material contained within the vial of "PTDSR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.