Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PRTFDC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 293T cell lysate)

Rabbit PRTFDC1 Polyclonal Antibody | anti-PRTFDC1 antibody

PRTFDC1 antibody - N-terminal region

Gene Names
PRTFDC1; HHGP
Reactivity
Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRTFDC1; Polyclonal Antibody; PRTFDC1 antibody - N-terminal region; anti-PRTFDC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVD
Sequence Length
225
Applicable Applications for anti-PRTFDC1 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PRTFDC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PRTFDC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-PRTFDC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 293T cell lysate)
Related Product Information for anti-PRTFDC1 antibody
This is a rabbit polyclonal antibody against PRTFDC1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PRTFDC1 belongs to the purine/pyrimidine phosphoribosyltransferase family. Epigenetic silencing of PRTFDC1 by hypermethylation of the CpG islands leads to a loss of PRTFDC1 function, which might be involved in squamous cell oral carcinogenesis.
Product Categories/Family for anti-PRTFDC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
phosphoribosyltransferase domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
phosphoribosyl transferase domain containing 1
NCBI Official Symbol
PRTFDC1
NCBI Official Synonym Symbols
HHGP
NCBI Protein Information
phosphoribosyltransferase domain-containing protein 1
UniProt Protein Name
Phosphoribosyltransferase domain-containing protein 1
UniProt Gene Name
PRTFDC1
UniProt Synonym Gene Names
HHGP
UniProt Entry Name
PRDC1_HUMAN

Uniprot Description

PRTFDC1: Has low, barely detectable phosphoribosyltransferase activity (in vitro). Binds GMP, IMP and alpha-D-5-phosphoribosyl 1-pyrophosphate (PRPP). Is not expected to contribute to purine metabolism or GMP salvage. Belongs to the purine/pyrimidine phosphoribosyltransferase family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 10p12.1

Cellular Component: cytosol

Molecular Function: protein homodimerization activity; nucleotide binding; hypoxanthine phosphoribosyltransferase activity; magnesium ion binding

Biological Process: GMP catabolic process; hypoxanthine metabolic process; IMP salvage; GMP salvage; adenine salvage; purine ribonucleoside salvage; guanine salvage

Research Articles on PRTFDC1

Similar Products

Product Notes

The PRTFDC1 prtfdc1 (Catalog #AAA3209204) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRTFDC1 antibody - N-terminal region reacts with Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRTFDC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRTFDC1 prtfdc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGSSEEAPDY GRGVVIMDDW PGYDLNLFTY PQHYYGDLEY VLIPHGIIVD. It is sometimes possible for the material contained within the vial of "PRTFDC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.