Western Blot (WB)
(Host: RabbitTarget Name: PRSS36Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit PRSS36 Polyclonal Antibody | anti-PRSS36 antibody
PRSS36 Antibody - N-terminal region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRSS36; Polyclonal Antibody; PRSS36 Antibody - N-terminal region; anti-PRSS36 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HLLLPLVMLVISPIPGAFQDSALSPTQEEPEDLDCGRPEPSARIVGGSNA
Sequence Length
855
Applicable Applications for anti-PRSS36 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 85%; Rat: 85%; Yeast: 89%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PRSS36
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PRSS36Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PRSS36Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PRSS36 antibody
This is a rabbit polyclonal antibody against PRSS36. It was validated on Western Blot
Target Description: PRSS36 is a Serine protease. It hydrolyzes the peptides N-t-Boc-Gln- Ala-Arg-AMC and N-t-Boc-Gln-Gly-Arg-AMC and, to a lesser extent, N-t-Boc-Ala-Phe-Lys-AMC and N-t-Boc-Val-Leu-Lys-AMC. It has a preference for substrates with an Arg instead of a Lys residue in position P1.
Target Description: PRSS36 is a Serine protease. It hydrolyzes the peptides N-t-Boc-Gln- Ala-Arg-AMC and N-t-Boc-Gln-Gly-Arg-AMC and, to a lesser extent, N-t-Boc-Ala-Phe-Lys-AMC and N-t-Boc-Val-Leu-Lys-AMC. It has a preference for substrates with an Arg instead of a Lys residue in position P1.
Product Categories/Family for anti-PRSS36 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
polyserase-2 isoform 1
NCBI Official Synonym Full Names
serine protease 36
NCBI Official Symbol
PRSS36
NCBI Protein Information
polyserase-2
UniProt Protein Name
Polyserase-2
Protein Family
UniProt Gene Name
PRSS36
Uniprot Description
PRSS36: Serine protease. Hydrolyzes the peptides N-t-Boc-Gln- Ala-Arg-AMC and N-t-Boc-Gln-Gly-Arg-AMC and, to a lesser extent, N-t-Boc-Ala-Phe-Lys-AMC and N-t-Boc-Val-Leu-Lys-AMC. Has a preference for substrates with an Arg instead of a Lys residue in position P1. Belongs to the peptidase S1 family.
Protein type: EC 3.4.21.-; Protease; Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 16p11.2
Cellular Component: cytoplasm; proteinaceous extracellular matrix
Molecular Function: serine-type endopeptidase activity
Biological Process: proteolysis
Research Articles on PRSS36
Similar Products
Product Notes
The PRSS36 prss36 (Catalog #AAA3218886) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRSS36 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's PRSS36 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRSS36 prss36 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HLLLPLVMLV ISPIPGAFQD SALSPTQEEP EDLDCGRPEP SARIVGGSNA. It is sometimes possible for the material contained within the vial of "PRSS36, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
