Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TMPRSS9Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit TMPRSS9 Polyclonal Antibody | anti-TMPRSS9 antibody

TMPRSS9 Antibody - C-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMPRSS9; Polyclonal Antibody; TMPRSS9 Antibody - C-terminal region; anti-TMPRSS9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PVGRKCMISGWGNTQEGNATKPELLQKASVGIIDQKTCSVLYNFSLTDRM
Sequence Length
1059
Applicable Applications for anti-TMPRSS9 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMPRSS9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TMPRSS9Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TMPRSS9Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TMPRSS9 antibody
This is a rabbit polyclonal antibody against TMPRSS9. It was validated on Western Blot

Target Description: Serase-1 and serase-2 are serine proteases that hydrolyze the peptides N-t-Boc-Gln-Ala-Arg-AMC and N-t-Boc-Gln-Gly-Arg-AMC. In contrast, N-t-Boc-Ala-Phe-Lys-AMC and N-t-Boc-Ala-Pro-Ala-AMC are not significantly hydrolyzed.
Product Categories/Family for anti-TMPRSS9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
transmembrane protease serine 9
NCBI Official Synonym Full Names
transmembrane serine protease 9
NCBI Official Symbol
TMPRSS9
NCBI Protein Information
transmembrane protease serine 9
UniProt Protein Name
Transmembrane protease serine 9
UniProt Gene Name
TMPRSS9
UniProt Synonym Gene Names
Polyserase-1
UniProt Entry Name
TMPS9_HUMAN

NCBI Description

The protein encoded by this gene is a membrane-bound type II serine polyprotease that is cleaved to release three different proteases. Two of the proteases are active and can be inhibited by serine protease inhibitors, and one is thought to be catalytically inactive. This gene enhances the invasive capability of pancreatic cancer cells and may be involved in cancer progression. [provided by RefSeq, Jul 2016]

Uniprot Description

Function: Serase-1 and serase-2 are serine proteases that hydrolyze the peptides N-t-Boc-Gln-Ala-Arg-AMC and N-t-Boc-Gln-Gly-Arg-AMC. In contrast, N-t-Boc-Ala-Phe-Lys-AMC and N-t-Boc-Ala-Pro-Ala-AMC are not significantly hydrolyzed.

Enzyme regulation: Inhibited by serine protease inhibitors PMSF and 4-(2-aminoethyl)benzenesulfonyl fluoride, but not by EDTA. Ref.1

Subcellular location: Cell membrane; Single-pass type II membrane protein Ref.1.

Tissue specificity: Expressed in fetal human tissues, such as kidney, liver, lung and brain, and in a variety of tumor cell lines. Weakly expressed in adult tissues including skeletal muscle, liver, placenta and heart. Ref.1

Domain: The serine protease 1 and 2 domains are catalytically active, whereas the serine protease 3 domain lacks the essential Ser residue of the catalytic triad at position 1009 and is predicted to be inactive.

Post-translational modification: Proteolytically cleaved to generate 3 independent serine protease chains. The cleaved chains may remain attached to the membrane thanks to disufide bonds. It is unclear whether cleavage always takes place. Ref.1

Sequence similarities: Belongs to the peptidase S1 family.Contains 1 LDL-receptor class A domain.Contains 3 peptidase S1 domains.

Sequence caution: The sequence BAD18439.1 differs from that shown. Reason: Frameshift at position 776. The sequence CAD35759.1 differs from that shown. Reason: Aberrant splicing.

Research Articles on TMPRSS9

Similar Products

Product Notes

The TMPRSS9 tmprss9 (Catalog #AAA3217640) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMPRSS9 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMPRSS9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMPRSS9 tmprss9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PVGRKCMISG WGNTQEGNAT KPELLQKASV GIIDQKTCSV LYNFSLTDRM. It is sometimes possible for the material contained within the vial of "TMPRSS9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.