Western Blot (WB)
(Host: RabbitTarget Name: TMPRSS11ESample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Rabbit TMPRSS11E Polyclonal Antibody | anti-TMPRSS11E antibody
TMPRSS11E Antibody - N-terminal region
Gene Names
TMPRSS11E; DESC1; TMPRSS11E2
Reactivity
Reacts with: HumanPredicted reacts with: Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMPRSS11E; Polyclonal Antibody; TMPRSS11E Antibody - N-terminal region; anti-TMPRSS11E antibody
Host
Rabbit
Reactivity
Reacts with: Human
Predicted reacts with: Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Predicted reacts with: Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CIGLTVHYVRYNQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLE
Sequence Length
423
Applicable Applications for anti-TMPRSS11E antibody
Western Blot (WB)
Homology
Dog: 92%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMPRSS11E
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TMPRSS11ESample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TMPRSS11ESample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TMPRSS11E antibody
This is a rabbit polyclonal antibody against TMPRSS11E. It was validated on Western Blot
Target Description: TMPRSS11E is a Serine protease which possesses both gelatinolytic and caseinolytic activities. It shows a preference for Arg in the P1 position.
Target Description: TMPRSS11E is a Serine protease which possesses both gelatinolytic and caseinolytic activities. It shows a preference for Arg in the P1 position.
Product Categories/Family for anti-TMPRSS11E antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
transmembrane protease serine 11E
NCBI Official Synonym Full Names
transmembrane serine protease 11E
NCBI Official Symbol
TMPRSS11E
NCBI Official Synonym Symbols
DESC1; TMPRSS11E2
NCBI Protein Information
transmembrane protease serine 11E
UniProt Protein Name
Transmembrane protease serine 11E
Protein Family
UniProt Gene Name
TMPRSS11E
UniProt Synonym Gene Names
DESC1; TMPRSS11E2
UniProt Entry Name
TM11E_HUMAN
Uniprot Description
Function: Serine protease which possesses both gelatinolytic and caseinolytic activities. Shows a preference for Arg in the P1 position
By similarity.
Enzyme regulation: Inhibited by SERPINA5. Ref.5
Subunit structure: Forms a heterodimer with SERPINA5 and SERPINE1.
Subcellular location: Cell membrane; Single-pass type II membrane protein
By similarity. Transmembrane protease serine 11E catalytic chain: Secreted
By similarity. Note: Activated by cleavage and secreted
By similarity.
Tissue specificity: Expression can only be detected in tissues derived from the head and neck, and in skin, prostate and testis. Ref.1
Post-translational modification: N-glycosylated
By similarity.
Sequence similarities: Belongs to the peptidase S1 family.Contains 1 peptidase S1 domain.Contains 1 SEA domain.
Caution: It is uncertain whether Met-1 or Met-2 is the initiator.
Research Articles on TMPRSS11E
Similar Products
Product Notes
The TMPRSS11E tmprss11e (Catalog #AAA3218991) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMPRSS11E Antibody - N-terminal region reacts with Reacts with: Human Predicted reacts with: Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMPRSS11E can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMPRSS11E tmprss11e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CIGLTVHYVR YNQKKTYNYY STLSFTTDKL YAEFGREASN NFTEMSQRLE. It is sometimes possible for the material contained within the vial of "TMPRSS11E, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
