Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PRKRA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)

Rabbit PRKRA Polyclonal Antibody | anti-PRKRA antibody

PRKRA antibody - N-terminal region

Gene Names
PRKRA; RAX; PACT; DYT16; HSD14
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRKRA; Polyclonal Antibody; PRKRA antibody - N-terminal region; anti-PRKRA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIP
Sequence Length
313
Applicable Applications for anti-PRKRA antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PRKRA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PRKRA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-PRKRA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Related Product Information for anti-PRKRA antibody
This is a rabbit polyclonal antibody against PRKRA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
interferon-inducible double-stranded RNA-dependent protein kinase activator A isoform 1
NCBI Official Synonym Full Names
protein activator of interferon induced protein kinase EIF2AK2
NCBI Official Symbol
PRKRA
NCBI Official Synonym Symbols
RAX; PACT; DYT16; HSD14
NCBI Protein Information
interferon-inducible double-stranded RNA-dependent protein kinase activator A
UniProt Protein Name
Interferon-inducible double-stranded RNA-dependent protein kinase activator A
UniProt Gene Name
PRKRA
UniProt Synonym Gene Names
PACT; RAX
UniProt Entry Name
PRKRA_HUMAN

NCBI Description

This gene encodes a protein kinase activated by double-stranded RNA which mediates the effects of interferon in response to viral infection. Mutations in this gene have been associated with dystonia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2008]

Uniprot Description

PACT: a double strand RNA binding protein (dsRBP). Interacts with TRBP and Dicer to stimulate the cleavage of double-stranded or short hairpin RNA to siRNA. Appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor. Activates the interferon-induced protein kinase PKR. Three alternatively spliced human isoforms have been reported.

Protein type: Activator; RNA processing; RNA-binding

Chromosomal Location of Human Ortholog: 2q31.2

Cellular Component: cytoplasm; cytosol; membrane; nucleoplasm

Molecular Function: double-stranded RNA binding; enzyme binding; identical protein binding; protein binding; protein homodimerization activity

Biological Process: immune response; miRNA-mediated gene silencing, production of miRNAs; negative regulation of cell proliferation; pre-microRNA processing; response to virus; RNA interference, production of siRNA; RNA-mediated gene silencing

Disease: Dystonia 16

Research Articles on PRKRA

Similar Products

Product Notes

The PRKRA prkra (Catalog #AAA3205260) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKRA antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRKRA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRKRA prkra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSQSRHRAEA PPLEREDSGT FSLGKMITAK PGKTPIQVLH EYGMKTKNIP. It is sometimes possible for the material contained within the vial of "PRKRA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.