Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PRKG1 rabbit polyclonal antibody. Western Blot analysis of PRKG1 expression in IMR-32.)

Rabbit anti-Human PRKG1 Polyclonal Antibody | anti-PRKG1 antibody

PRKG1 (cGMP-dependent Protein Kinase 1, cGK 1, cGK1, cGMP-dependent Protein Kinase I, cGKI, PRKG1B, PRKGR1A, PRKGR1B, DKFZp686K042, FLJ36117, MGC71944) (Biotin)

Gene Names
PRKG1; PKG; cGK; AAT8; PKG1; cGK1; cGKI; cGK 1; PRKG1B; PRKGR1B; cGKI-BETA; cGKI-alpha
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRKG1; Polyclonal Antibody; PRKG1 (cGMP-dependent Protein Kinase 1; cGK 1; cGK1; cGMP-dependent Protein Kinase I; cGKI; PRKG1B; PRKGR1A; PRKGR1B; DKFZp686K042; FLJ36117; MGC71944) (Biotin); anti-PRKG1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PRKG1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1217
Applicable Applications for anti-PRKG1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PRKG1, aa1-312 (AAH62688.1).
Immunogen Sequence
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQG
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PRKG1 rabbit polyclonal antibody. Western Blot analysis of PRKG1 expression in IMR-32.)

Western Blot (WB) (PRKG1 rabbit polyclonal antibody. Western Blot analysis of PRKG1 expression in IMR-32.)

Western Blot (WB)

(Western Blot analysis of PRKG1 expression in transfected 293T cell line by PRKG1 polyclonal antibody. Lane 1: PRKG1 transfected lysate (35.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PRKG1 expression in transfected 293T cell line by PRKG1 polyclonal antibody. Lane 1: PRKG1 transfected lysate (35.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PRKG1 antibody
PKGs are cyclic GMP-dependent protein kinases (also designed cGKs) that are classified into two types, PKGI and PKGII. Studies have shown that cGKs and cyclic AMP-dependent kinases (cAKs) are highly homologous protein kinase families with similar substrate specificities. Phosphorylation of cellular proteins by both families of kinases leads to alterations in calcium mobilization, protein phosphatase activity, ion channel function, gene transcription, smooth muscle contractility and platelet aggregation. However, recent studies using mice deficient in PKGs have shown that cGMP kinases regulate very specifically distinct pathways which are separate from those used by cyclic AMP kinases.
Product Categories/Family for anti-PRKG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens protein kinase, cGMP-dependent, type I, mRNA
NCBI Official Synonym Full Names
protein kinase cGMP-dependent 1
NCBI Official Symbol
PRKG1
NCBI Official Synonym Symbols
PKG; cGK; AAT8; PKG1; cGK1; cGKI; cGK 1; PRKG1B; PRKGR1B; cGKI-BETA; cGKI-alpha
NCBI Protein Information
cGMP-dependent protein kinase 1

NCBI Description

Mammals have three different isoforms of cyclic GMP-dependent protein kinase (Ialpha, Ibeta, and II). These PRKG isoforms act as key mediators of the nitric oxide/cGMP signaling pathway and are important components of many signal transduction processes in diverse cell types. This PRKG1 gene on human chromosome 10 encodes the soluble Ialpha and Ibeta isoforms of PRKG by alternative transcript splicing. A separate gene on human chromosome 4, PRKG2, encodes the membrane-bound PRKG isoform II. The PRKG1 proteins play a central role in regulating cardiovascular and neuronal functions in addition to relaxing smooth muscle tone, preventing platelet aggregation, and modulating cell growth. This gene is most strongly expressed in all types of smooth muscle, platelets, cerebellar Purkinje cells, hippocampal neurons, and the lateral amygdala. Isoforms Ialpha and Ibeta have identical cGMP-binding and catalytic domains but differ in their leucine/isoleucine zipper and autoinhibitory sequences and therefore differ in their dimerization substrates and kinase enzyme activity. [provided by RefSeq, Sep 2011]

Research Articles on PRKG1

Similar Products

Product Notes

The PRKG1 (Catalog #AAA6390771) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKG1 (cGMP-dependent Protein Kinase 1, cGK 1, cGK1, cGMP-dependent Protein Kinase I, cGKI, PRKG1B, PRKGR1A, PRKGR1B, DKFZp686K042, FLJ36117, MGC71944) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRKG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRKG1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.