Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human testis tissue using MBS7044713 at dilution of 1:100)

Rabbit anti-Human KCNK16 Polyclonal Antibody | anti-KCNK16 antibody

KCNK16 Antibody

Gene Names
KCNK16; TALK1; TALK-1; K2p16.1
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
>95%, Protein G purified
Synonyms
KCNK16; Polyclonal Antibody; KCNK16 Antibody; Potassium channel subfamily K member 16; 2P domain potassium channel Talk-1; TWIK-related alkaline pH-activated K(+) channel 1; TALK-1; TALK1; anti-KCNK16 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
>95%, Protein G purified
Form/Format
Liquid
Sequence Positions
259-309
Sequence
HRCCQLWLLSLRQGCGAKAAPGRRPRRGSTAARGVQVTPQDFPISKKGLGS
Sequence Length
309
Applicable Applications for anti-KCNK16 antibody
ELISA (EIA), Immunohistochemistry (IHC)
Species
Human
Immunogen
Recombinant human Potassium channel subfamily K member 16 protein (259-309aa).
Conjugate
Non-conjugated
Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M PBS, PH 7.4
Santa Cruz Alternative
Potential replacement for Santa Cruz Biotechnology antibody catalog# sc-50997 / sc-50994
Preparation and Storage
Shipped at 4 degree C. Upon delivery aliquot and store at -20 degree C or -80 degree C. Avoid repeated freeze.

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human testis tissue using MBS7044713 at dilution of 1:100)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human testis tissue using MBS7044713 at dilution of 1:100)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human small intestine tissue using MBS7044713 at dilution of 1:100)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human small intestine tissue using MBS7044713 at dilution of 1:100)
Related Product Information for anti-KCNK16 antibody
Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K(+) currents.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,828 Da
NCBI Official Full Name
potassium channel subfamily K member 16 isoform 1
NCBI Official Synonym Full Names
potassium two pore domain channel subfamily K member 16
NCBI Official Symbol
KCNK16
NCBI Official Synonym Symbols
TALK1; TALK-1; K2p16.1
NCBI Protein Information
potassium channel subfamily K member 16
UniProt Protein Name
Potassium channel subfamily K member 16
UniProt Gene Name
KCNK16
UniProt Synonym Gene Names
TALK1; TALK-1
UniProt Entry Name
KCNKG_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. This gene is expressed predominantly in the pancreas and is activated at alkaline pH. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Sep 2008]

Uniprot Description

KCNK16: Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K(+) currents. Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 6p21.2-p21.1

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: potassium channel activity; potassium ion leak channel activity; protein binding

Biological Process: potassium ion transport; stabilization of membrane potential

Research Articles on KCNK16

Similar Products

Product Notes

The KCNK16 kcnk16 (Catalog #AAA7044713) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 259-309. The KCNK16 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KCNK16 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the KCNK16 kcnk16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HRCCQLWLLS LRQGCGAKAA PGRRPRRGST AARGVQVTPQ DFPISKKGLG S . It is sometimes possible for the material contained within the vial of "KCNK16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.