Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PCPSample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PRCP Polyclonal Antibody | anti-PRCP antibody

PRCP Antibody - N-terminal region

Gene Names
PRCP; PCP; HUMPCP
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRCP; Polyclonal Antibody; PRCP Antibody - N-terminal region; anti-PRCP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VAEELKAMLVFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELI
Sequence Length
496
Applicable Applications for anti-PRCP antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PCP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PCPSample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PCPSample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PRCP antibody
This is a rabbit polyclonal antibody against PCP. It was validated on Western Blot

Target Description: This gene encodes a member of the peptidase S28 family of serine exopeptidases. The encoded preproprotein is proteolytically processed to generate the mature lysosomal prolylcarboxypeptidase. This enzyme cleaves C-terminal amino acids linked to proline in peptides such as angiotension II, III and des-Arg9-bradykinin. The cleavage occurs at acidic pH, but the enzyme activity is retained with some substrates at neutral pH. This enzyme has been shown to be an activator of the cell matrix-associated prekallikrein. The importance of angiotension II, one of the substrates of this enzyme, in regulating blood pressure and electrolyte balance suggests that this gene may be related to essential hypertension. A pseudogene of this gene has been identified on chromosome 2. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
Product Categories/Family for anti-PRCP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
Lysosomal Pro-X carboxypeptidase
NCBI Official Synonym Full Names
prolylcarboxypeptidase
NCBI Official Symbol
PRCP
NCBI Official Synonym Symbols
PCP; HUMPCP
NCBI Protein Information
lysosomal Pro-X carboxypeptidase
UniProt Protein Name
Lysosomal Pro-X carboxypeptidase
UniProt Gene Name
PRCP
UniProt Synonym Gene Names
PCP; PRCP
UniProt Entry Name
PCP_HUMAN

NCBI Description

This gene encodes a member of the peptidase S28 family of serine exopeptidases. The encoded preproprotein is proteolytically processed to generate the mature lysosomal prolylcarboxypeptidase. This enzyme cleaves C-terminal amino acids linked to proline in peptides such as angiotension II, III and des-Arg9-bradykinin. The cleavage occurs at acidic pH, but the enzyme activity is retained with some substrates at neutral pH. This enzyme has been shown to be an activator of the cell matrix-associated prekallikrein. The importance of angiotension II, one of the substrates of this enzyme, in regulating blood pressure and electrolyte balance suggests that this gene may be related to essential hypertension. A pseudogene of this gene has been identified on chromosome 2. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]

Uniprot Description

PRCP: Cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH. Belongs to the peptidase S28 family.

Protein type: EC 3.4.16.2; Protease

Chromosomal Location of Human Ortholog: 11q14

Cellular Component: lysosome; plasma membrane

Molecular Function: serine carboxypeptidase activity; protein binding

Biological Process: plasma kallikrein-kinin cascade; negative regulation of systemic arterial blood pressure; regulation of blood vessel endothelial cell migration; glucose homeostasis; proteolysis; blood coagulation; angiogenesis involved in wound healing; blood coagulation, intrinsic pathway

Research Articles on PRCP

Similar Products

Product Notes

The PRCP prcp (Catalog #AAA3219550) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRCP Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRCP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRCP prcp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VAEELKAMLV FAEHRYYGES LPFGDNSFKD SRHLNFLTSE QALADFAELI. It is sometimes possible for the material contained within the vial of "PRCP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.