Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PRAME Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

Rabbit PRAME Polyclonal Antibody | anti-PRAME antibody

PRAME antibody - N-terminal region

Gene Names
PRAME; MAPE; OIP4; CT130; OIP-4
Reactivity
Cow, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRAME; Polyclonal Antibody; PRAME antibody - N-terminal region; anti-PRAME antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ
Sequence Length
509
Applicable Applications for anti-PRAME antibody
Western Blot (WB)
Homology
Cow: 92%; Horse: 79%; Human: 100%; Mouse: 92%; Rabbit: 79%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PRAME
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PRAME Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-PRAME Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

Western Blot (WB)

(WB Suggested Anti-PRAME antibody Titration: 1 ug/mLSample Type: Human HepG2)

Western Blot (WB) (WB Suggested Anti-PRAME antibody Titration: 1 ug/mLSample Type: Human HepG2)

Western Blot (WB)

(WB Suggested Anti-PRAME antibody Titration: 1 ug/mLSample Type: Human K562)

Western Blot (WB) (WB Suggested Anti-PRAME antibody Titration: 1 ug/mLSample Type: Human K562)
Related Product Information for anti-PRAME antibody
This is a rabbit polyclonal antibody against PRAME. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PRAME functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG. PRAME prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis.This gene encodes an antigen that is predominantly expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. This expression pattern is similar to that of other CT antigens, such as MAGE, BAGE and GAGE. However, unlike these other CT antigens, this gene is also expressed in acute leukemias. Five alternatively spliced transcript variants encoding the same protein have been observed for this gene.
Product Categories/Family for anti-PRAME antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
melanoma antigen preferentially expressed in tumors isoform a
NCBI Official Synonym Full Names
preferentially expressed antigen in melanoma
NCBI Official Symbol
PRAME
NCBI Official Synonym Symbols
MAPE; OIP4; CT130; OIP-4
NCBI Protein Information
melanoma antigen preferentially expressed in tumors
UniProt Protein Name
Melanoma antigen preferentially expressed in tumors
Protein Family
UniProt Gene Name
PRAME
UniProt Synonym Gene Names
MAPE; OIP4; OIP-4
UniProt Entry Name
PRAME_HUMAN

NCBI Description

This gene encodes an antigen that is preferentially expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. The encoded protein acts as a repressor of retinoic acid receptor, and likely confers a growth advantage to cancer cells via this function. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]

Uniprot Description

PRAME: Functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG. Prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis. Belongs to the PRAME family.

Protein type: Nuclear receptor co-regulator; Cancer Testis Antigen (CTA); Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 22q11.22

Cellular Component: plasma membrane; nucleus

Molecular Function: protein binding; retinoic acid receptor binding

Biological Process: negative regulation of retinoic acid receptor signaling pathway; negative regulation of cell differentiation; transcription, DNA-dependent; apoptosis; regulation of growth; positive regulation of cell proliferation; cell differentiation; negative regulation of transcription, DNA-dependent; negative regulation of apoptosis

Research Articles on PRAME

Similar Products

Product Notes

The PRAME prame (Catalog #AAA3212506) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRAME antibody - N-terminal region reacts with Cow, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRAME can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRAME prame for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AMVQAWPFTC LPLGVLMKGQ HLHLETFKAV LDGLDVLLAQ EVRPRRWKLQ. It is sometimes possible for the material contained within the vial of "PRAME, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.