Mouse LILRA2 Monoclonal Antibody | anti-LILRA2 antibody

LILRA2 (Leukocyte Immunoglobulin-like Receptor, Subfamily A (with TM Domain), Member 2, CD85H, ILT1, LIR-7, LIR7) (APC)

Cat. Num. AAA6168715

• Gene Names: LILRA2; ILT1; LIR7; CD85H; LIR-7
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: LILRA2; Monoclonal Antibody; LILRA2 (Leukocyte Immunoglobulin-like Receptor; Subfamily A (with TM Domain); Member 2; CD85H; ILT1; LIR-7; LIR7) (APC); Leukocyte Immunoglobulin-like Receptor; LIR7; anti-LILRA2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4D7
• Specificity: Recognizes LILRA2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 466

• Applicable Applications for anti-LILRA2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: LILRA2 (AAH27916, 1aa-466aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSIAREHAGRYHCQYYSHNHSSEYSDPLELVVTGAYGKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSASLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LILRA2 expression in transfected 293T cell line by LILRA2 monoclonal antibody (M14), clone 4D7.Lane 1: LILRA2 transfected lysate (Predicted MW: 51.2 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-LILRA2 antibody

Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function (see, e.g., LILRB1, MIM 604811). LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. One member of subfamily A (LILRA3; MIM 604818) lacks a transmembrane region and is presumed to be a soluble receptor. [supplied by OMIM].

Product Categories/Family for anti-LILRA2 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 20381242
• NCBI GeneID: 11027
• NCBI Official Full Name: Leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2
• NCBI Official Synonym Full Names: leukocyte immunoglobulin like receptor A2
• NCBI Official Symbol: LILRA2
• NCBI Official Synonym Symbols: ILT1; LIR7; CD85H; LIR-7
• NCBI Protein Information: leukocyte immunoglobulin-like receptor subfamily A member 2
• Protein Family: Leukocyte immunoglobulin-like receptor subfamily

NCBI Description

This gene encodes a member of a family of immunoreceptors that are expressed predominantly on monocytes and B cells, and at lower levels on dendritic cells and natural killer cells. The encoded protein is an activating receptor that inhibits dendritic cell differentiation and antigen presentation and suppresses innate immune response. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and there is a pseudogene for this gene on chromosome 3. [provided by RefSeq, Mar 2014]