Western Blot (WB)
(WB Suggested Anti-Smek2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Rabbit PPP4R3B Polyclonal Antibody | anti-PPP4R3B antibody
PPP4R3B Antibody - C-terminal region
Gene Names
Ppp4r3b; Smek2; AW011752; AW557776; mKIAA1387
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPP4R3B; Polyclonal Antibody; PPP4R3B Antibody - C-terminal region; anti-PPP4R3B antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DSYEKFMETKKAKESEDKENLPKRASSGGFKFTFSHSPSATNGTNSTNSK
Sequence Length
820
Applicable Applications for anti-PPP4R3B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Smek2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Western Blot (WB)
(WB Suggested Anti-Smek2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Related Product Information for anti-PPP4R3B antibody
This is a rabbit polyclonal antibody against Smek2. It was validated on Western Blot
Product Categories/Family for anti-PPP4R3B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 4 regulatory subunit 3B isoform 1
NCBI Official Synonym Full Names
protein phosphatase 4 regulatory subunit 3B
NCBI Official Symbol
Ppp4r3b
NCBI Official Synonym Symbols
Smek2; AW011752; AW557776; mKIAA1387
NCBI Protein Information
serine/threonine-protein phosphatase 4 regulatory subunit 3B
UniProt Protein Name
Serine/threonine-protein phosphatase 4 regulatory subunit 3B
Protein Family
UniProt Gene Name
Smek2
UniProt Synonym Gene Names
Kiaa1387; Pp4r3b; Ppp4r3b
UniProt Entry Name
P4R3B_MOUSE
Research Articles on PPP4R3B
Similar Products
Product Notes
The PPP4R3B smek2 (Catalog #AAA3213357) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP4R3B Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PPP4R3B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP4R3B smek2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DSYEKFMETK KAKESEDKEN LPKRASSGGF KFTFSHSPSA TNGTNSTNSK. It is sometimes possible for the material contained within the vial of "PPP4R3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
