Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PPP2R5ASample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Rabbit PPP2R5A Polyclonal Antibody | anti-PPP2R5A antibody

PPP2R5A antibody - N-terminal region

Gene Names
PPP2R5A; B56A; PR61A; B56alpha
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPP2R5A; Polyclonal Antibody; PPP2R5A antibody - N-terminal region; anti-PPP2R5A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW
Sequence Length
486
Applicable Applications for anti-PPP2R5A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R5A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PPP2R5ASample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PPP2R5ASample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-PPP2R5A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-PPP2R5A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)
Related Product Information for anti-PPP2R5A antibody
This is a rabbit polyclonal antibody against PPP2R5A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PPP2R5A belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity.The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B56 subfamily. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-PPP2R5A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform isoform 1
NCBI Official Synonym Full Names
protein phosphatase 2 regulatory subunit B'alpha
NCBI Official Symbol
PPP2R5A
NCBI Official Synonym Symbols
B56A; PR61A; B56alpha
NCBI Protein Information
serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
UniProt Protein Name
Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
UniProt Gene Name
PPP2R5A
UniProt Synonym Gene Names
PR61alpha
UniProt Entry Name
2A5A_HUMAN

NCBI Description

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B56 subfamily. Alternative transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

PPP2R5A: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Belongs to the phosphatase 2A regulatory subunit B56 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein phosphatase, regulatory subunit; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1q32.2-q32.3

Cellular Component: protein phosphatase type 2A complex; membrane; cytoplasm; M band; Z disc; nucleus; chromosome, pericentric region

Molecular Function: protein binding; protein phosphatase type 2A regulator activity; kinase binding

Biological Process: signal transduction; positive regulation of protein amino acid dephosphorylation

Research Articles on PPP2R5A

Similar Products

Product Notes

The PPP2R5A ppp2r5a (Catalog #AAA3208827) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP2R5A antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PPP2R5A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP2R5A ppp2r5a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YVSTNRGVIV ESAYSDIVKM ISANIFRTLP PSDNPDFDPE EDEPTLEASW. It is sometimes possible for the material contained within the vial of "PPP2R5A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.