Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-PPP2R5A Polyclonal Antibody)

Rabbit anti-Human, Mouse PPP2R5A Polyclonal Antibody | anti-PPP2R5A antibody

PPP2R5A Polyclonal Antibody

Gene Names
PPP2R5A; B56A; PR61A; B56alpha
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
PPP2R5A; Polyclonal Antibody; PPP2R5A Polyclonal Antibody; B56A; PR61A; B56alpha; protein phosphatase 2 regulatory subunit B'alpha; anti-PPP2R5A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.11 mg/ml (varies by lot)
Sequence Length
429
Applicable Applications for anti-PPP2R5A antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 50-130 of human PPP2R5A (NP_006234.1).
Immunogen Sequence
QAELHPLPQLKDATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAYSDIVKMISAN
Positive Samples
MCF7, U-87MG, LO2, HeLa
Cellular Location
Chromosome, Cytoplasm, Nucleus, Centromere
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-PPP2R5A Polyclonal Antibody)

Western Blot (WB) (Western blot-PPP2R5A Polyclonal Antibody)
Related Product Information for anti-PPP2R5A antibody
The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B56 subfamily. Alternative transcript variants encoding distinct isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 50kDa; 56kDa
Observed: 56kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform isoform 2
NCBI Official Synonym Full Names
protein phosphatase 2 regulatory subunit B'alpha
NCBI Official Symbol
PPP2R5A
NCBI Official Synonym Symbols
B56A; PR61A; B56alpha
NCBI Protein Information
serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
UniProt Protein Name
Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
UniProt Gene Name
PPP2R5A
UniProt Synonym Gene Names
PR61alpha
UniProt Entry Name
2A5A_HUMAN

NCBI Description

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B56 subfamily. Alternative transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

PPP2R5A: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Belongs to the phosphatase 2A regulatory subunit B56 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein phosphatase, regulatory subunit; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1q32.2-q32.3

Cellular Component: protein phosphatase type 2A complex; membrane; cytoplasm; M band; Z disc; nucleus; chromosome, pericentric region

Molecular Function: protein binding; protein phosphatase type 2A regulator activity; kinase binding

Biological Process: signal transduction; positive regulation of protein amino acid dephosphorylation

Research Articles on PPP2R5A

Similar Products

Product Notes

The PPP2R5A ppp2r5a (Catalog #AAA9140439) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP2R5A Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PPP2R5A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the PPP2R5A ppp2r5a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPP2R5A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.