Western Blot (WB)
(Host: RabbitTarget Name: CENPC1Sample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human CENPC Polyclonal Antibody | anti-CENPC antibody
CENPC Antibody - C-terminal region
Gene Names
CENPC; MIF2; hcp-4; CENP-C; CENPC1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CENPC; Polyclonal Antibody; CENPC Antibody - C-terminal region; anti-CENPC antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QDTYQFFVKHGELKVYKTLDTPFFSTGKLILGPQEEKGKQHVGQDILVFY
Sequence Length
943
Applicable Applications for anti-CENPC antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of Human CENPC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CENPC1Sample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CENPC1Sample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CENPC antibody
Centromere protein C 1 is a centromere autoantigen and a component of the inner kinetochore plate. The protein is required for maintaining proper kinetochore size and a timely transition to anaphase. A putative pseudogene exists on chromosome 12.
Product Categories/Family for anti-CENPC antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107 kDa
NCBI Official Full Name
centromere protein C isoform 1
NCBI Official Synonym Full Names
centromere protein C
NCBI Official Symbol
CENPC
NCBI Official Synonym Symbols
MIF2; hcp-4; CENP-C; CENPC1
NCBI Protein Information
centromere protein C
UniProt Protein Name
Centromere protein C
Protein Family
UniProt Gene Name
CENPC
UniProt Synonym Gene Names
CENPC1; ICEN7; CENP-C; CENP-C 1
NCBI Description
Centromere protein C 1 is a centromere autoantigen and a component of the inner kinetochore plate. The protein is required for maintaining proper kinetochore size and a timely transition to anaphase. A putative pseudogene exists on chromosome 12. [provided by RefSeq, Jul 2008]
Uniprot Description
Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. CENPC recruits DNA methylation and DNMT3B to both centromeric and pericentromeric satellite repeats and regulates the histone code in these regions.
Research Articles on CENPC
Similar Products
Product Notes
The CENPC cenpc (Catalog #AAA3222279) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CENPC Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CENPC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CENPC cenpc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QDTYQFFVKH GELKVYKTLD TPFFSTGKLI LGPQEEKGKQ HVGQDILVFY. It is sometimes possible for the material contained within the vial of "CENPC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
